Mesocricetus auratus (golden hamster): 121139838 Help Entry 121139838         CDS       T08306                                  Name (RefSeq) histone H3-like   KO K11253   histone H3 Organism maua  Mesocricetus auratus (golden hamster) Pathway maua04613   Neutrophil extracellular trap formation maua05034   Alcoholism maua05202   Transcriptional misregulation in cancer maua05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:maua00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     121139838  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     121139838   09163 Immune disease    05322 Systemic lupus erythematosus     121139838   09165 Substance dependence    05034 Alcoholism     121139838  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:maua03036]     121139838   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:maua04147]     121139838 Chromosome and associated proteins [BR:maua03036]  Eukaryotic type   Nucleosome assembly factors    Histones     121139838 Exosome [BR:maua04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121139838 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S PAF CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  121139838 NCBI-ProteinID:  XP_040599774 UniProt:  A0ABM2XAD8 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MVRTKQTARKSTGGKAPRKPLAMNVACKTAPATGVVKKKQRRYRPGTVALREIRRYQKTT ELLIRRAPFQHLVREIAQGFKTDLRFQSSALMALQEACEAYLVALFEDTNLCAIHAKRVT IMPKDIHLARRIRGEHS NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atggtacgcaccaagcagacagcgcggaagtcgacgggaggcaaggctccacggaagccg ctagctatgaatgtggcttgcaagactgcaccggctactggcgtagtgaagaagaagcag cgccgctaccgcccaggcaccgtggcgcttcgtgagatccgccgctaccagaagaccacc gagttgctgattcgcagggcgccgttccagcacttggtgcgtgagatagcccagggtttc aagactgacctgcgcttccagagctctgcgctgatggcgctgcaggaggcctgcgaggcc tacctcgtggcgctgttcgaagacaccaacctgtgtgccatccacgccaagcgggtgacc atcatgccgaaagacatccacctggctcgtcgcattcgcggagagcactcttaa

DBGET integrated database retrieval system