Mesocricetus auratus (golden hamster): 121142393 Help Entry 121142393         CDS       T08306                                  Name (RefSeq) histone H2A type 2-A   KO K11251   histone H2A Organism maua  Mesocricetus auratus (golden hamster) Pathway maua03082   ATP-dependent chromatin remodeling maua04217   Necroptosis maua04613   Neutrophil extracellular trap formation maua05034   Alcoholism maua05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:maua00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     121142393  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     121142393  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     121142393  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     121142393   09165 Substance dependence    05034 Alcoholism     121142393  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:maua03036]     121142393   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:maua04147]     121142393 Chromosome and associated proteins [BR:maua03036]  Eukaryotic type   Nucleosome assembly factors    Histones     121142393 Exosome [BR:maua04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121142393 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  121142393 NCBI-ProteinID:  XP_040608137 UniProt:  A0ABM2XZS7 LinkDB All DBs Position Unknown AA seq 130 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHHKAKGK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtctggccgcggtaagcaaggaggcaaggctcgcgccaaagccaagtcgcggtcgtcg cgcgccgggctgcagttcccagtggggcgcgtgcaccggctgctgcgcaagggcaactac gcggagcgcgtgggcgccggcgcgcccgtgtacatggcggccgtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggcaaa gtgaccatcgcccagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag accgagagccaccataaggcaaagggcaagtga

DBGET integrated database retrieval system