Mesocricetus auratus (golden hamster): 121144010 Help Entry 121144010         CDS       T08306                                  Name (RefSeq) histone H2A.Z-like   KO K11251   histone H2A Organism maua  Mesocricetus auratus (golden hamster) Pathway maua03082   ATP-dependent chromatin remodeling maua04217   Necroptosis maua04613   Neutrophil extracellular trap formation maua05034   Alcoholism maua05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:maua00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     121144010  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     121144010  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     121144010  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     121144010   09165 Substance dependence    05034 Alcoholism     121144010  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:maua03036]     121144010   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:maua04147]     121144010 Chromosome and associated proteins [BR:maua03036]  Eukaryotic type   Nucleosome assembly factors    Histones     121144010 Exosome [BR:maua04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121144010 SSDB OrthologParalogGFIT Motif Pfam:  Histone Histone_H2A_C Histone_ABTB CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  121144010 NCBI-ProteinID:  XP_040613046 UniProt:  A0ABM2YG29 LinkDB All DBs Position Unknown AA seq 128 aa AA seqDB search MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILE YLTAEVLELAGNASKDLKVKRITPHHLQLAIRGDEELDSLIKATIVGGGVIPHIHKSLIG KKGQQKTV NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggctggcggtaaggctggaaaggactccggaaaggccaagacaaaggcggtttcccgc tctcagcgagccggcttgcagttccctgtgggccgtattcatcgacacctgaaatctagg acaaccagccatggacgtgtgggcgcgaccgccgctgtgtacagcgcagccatcctggag tacctcaccgcagaggtactagagttggcaggaaatgcatcaaaagacttaaaggtaaag cgtattactcctcatcacttgcaacttgctattcgtggggatgaagaattggactccctg atcaaggctacaattgttggtggtggtgtcatcccacacatccacaagtctctgattggg aagaaaggacaacagaagactgtctaa

DBGET integrated database retrieval system