Mesocricetus auratus (golden hamster): 121144104 Help Entry 121144104         CDS       T08306                                  Name (RefSeq) interferon alpha-12-like   KO K05414   interferon alpha Organism maua  Mesocricetus auratus (golden hamster) Pathway maua04060   Cytokine-cytokine receptor interaction maua04151   PI3K-Akt signaling pathway maua04217   Necroptosis maua04620   Toll-like receptor signaling pathway maua04621   NOD-like receptor signaling pathway maua04622   RIG-I-like receptor signaling pathway maua04623   Cytosolic DNA-sensing pathway maua04630   JAK-STAT signaling pathway maua04650   Natural killer cell mediated cytotoxicity maua04936   Alcoholic liver disease maua05152   Tuberculosis maua05160   Hepatitis C maua05161   Hepatitis B maua05162   Measles maua05163   Human cytomegalovirus infection maua05164   Influenza A maua05165   Human papillomavirus infection maua05167   Kaposi sarcoma-associated herpesvirus infection maua05168   Herpes simplex virus 1 infection maua05169   Epstein-Barr virus infection maua05170   Human immunodeficiency virus 1 infection maua05171   Coronavirus disease - COVID-19 maua05200   Pathways in cancer maua05320   Autoimmune thyroid disease maua05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:maua00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     121144104    04151 PI3K-Akt signaling pathway     121144104   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121144104  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     121144104  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     121144104    04621 NOD-like receptor signaling pathway     121144104    04622 RIG-I-like receptor signaling pathway     121144104    04623 Cytosolic DNA-sensing pathway     121144104    04650 Natural killer cell mediated cytotoxicity     121144104  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121144104   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     121144104    05161 Hepatitis B     121144104    05160 Hepatitis C     121144104    05171 Coronavirus disease - COVID-19     121144104    05164 Influenza A     121144104    05162 Measles     121144104    05168 Herpes simplex virus 1 infection     121144104    05163 Human cytomegalovirus infection     121144104    05167 Kaposi sarcoma-associated herpesvirus infection     121144104    05169 Epstein-Barr virus infection     121144104    05165 Human papillomavirus infection     121144104   09171 Infectious disease: bacterial    05152 Tuberculosis     121144104   09163 Immune disease    05320 Autoimmune thyroid disease     121144104   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121144104   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     121144104  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:maua04052]     121144104 Cytokines and neuropeptides [BR:maua04052]  Cytokines   Interferons    121144104 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon RIX1 Motif Other DBs NCBI-GeneID:  121144104 NCBI-ProteinID:  XP_040613380 LinkDB All DBs Position Unknown AA seq 190 aa AA seqDB search MTRPCAFLMGLVVMNYWSTCCLGCDLPQTHNLRNKRALTLLTQMRRLSPLSCLKDRKDFA FPLEKVDAQHMQKAQAIPVLQELTQQVLILFSSKDSSAAWETALLDTFCSGLHQQLSDLQ ACLMQQVGEQEPALSQEDSLVAVRKYFQRITVYLREKNHSPCAWEVVRAEVWRALSSSAN LLARLSEEEE NT seq 573 nt NT seq  +upstreamnt  +downstreamnt atgactagaccctgtgctttcctaatgggcctagtggtgatgaactactggtcaacttgc tgtctgggatgtgaccttcctcagactcataacctcaggaacaagagagccttgacactc ctgacacaaatgaggagactctcccctctctcctgcctgaaggacagaaaggactttgca ttccctctggagaaggtggatgcccagcacatgcagaaggctcaagccatccctgtcctg caggagctgacccagcaggtcctgatcctcttcagctccaaggactcatctgctgcttgg gagacagccctcctagacacattctgcagtggcctccaccagcagctcagtgacctgcaa gcctgtctgatgcagcaggttggggagcaggaacctgccctgagccaggaagactccctg gtggcagtgaggaaatacttccagaggatcactgtgtacctgagagagaagaaccacagc ccctgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctcagccaac ttgctggcaagattgagtgaggaggaggaataa

DBGET integrated database retrieval system