Mycolicibacterium aubagnense: MAUB_17430 Help Entry MAUB_17430        CDS       T07121                                  Name (GenBank) hypothetical protein   KO K27095   acyl-CoA carboxylase epsilon subunit Organism maub  Mycolicibacterium aubagnense Pathway maub00074   Mycolic acid biosynthesis maub00280   Valine, leucine and isoleucine degradation maub00630   Glyoxylate and dicarboxylate metabolism maub00640   Propanoate metabolism maub01100   Metabolic pathways maub01110   Biosynthesis of secondary metabolites maub01120   Microbial metabolism in diverse environments maub01200   Carbon metabolism Module maub_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA maub_M00887   Mycolic acid biosynthesis, meromycolic acid + alpha-carboxyacyl-CoA + trehalose => TMM => TDM/mAGP/GMM Brite KEGG Orthology (KO) [BR:maub00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     MAUB_17430    00640 Propanoate metabolism     MAUB_17430   09103 Lipid metabolism    00074 Mycolic acid biosynthesis     MAUB_17430   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     MAUB_17430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACC_epsilon Motif Other DBs NCBI-ProteinID:  BBX83870 UniProt:  A0ABN5YQ01 LinkDB All DBs Position 1768783..1769064 Genome browser AA seq 93 aa AA seqDB search MSGANGSAVVSADNVSETDAAAEAPVAPLFQVVKGNPSDEELAALVTVLASASGGGAAEA GDRNDWGHPVSKLRYAYTSWQLVTLVERTFIRR NT seq 282 nt NT seq  +upstreamnt  +downstreamnt gtgagcggcgcgaacggttcggctgtggtgagcgccgacaacgtgtccgaaaccgatgcc gccgcggaagcgcccgtcgcgccgctgttccaggtcgtcaagggcaacccgtccgacgag gagctcgctgctctggtgacggtgctggccagcgcctccggcggcggtgccgccgaggcc ggcgaccgcaacgactggggtcacccggtctccaagctgcggtacgcgtacaccagctgg cagctggtaaccctggtggagcgcaccttcattcgtcgctga

DBGET integrated database retrieval system