Microbacterium aurugineum: KV397_07350 Help Entry KV397_07350       CDS       T10179                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism maug  Microbacterium aurugineum Pathway maug00998   Biosynthesis of various antibiotics maug01100   Metabolic pathways maug01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:maug00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KV397_07350    00074 Mycolic acid biosynthesis     KV397_07350   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KV397_07350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  UPL17581 UniProt:  A0ABY4IXT8 LinkDB All DBs Position complement(1513383..1513631) Genome browser AA seq 82 aa AA seqDB search MAFTNDEVLAGLAELITDETGINASEVALEKSFTDDLDIDSISMMTIVVNAEEKFGVTIP DDEVKNLKTVGDAVNFIVAGQE NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggctttcaccaacgatgaggtcctcgcgggcctcgcagagctcatcaccgacgagacc ggcatcaacgcctccgaggtcgccctggaaaagtcgttcaccgacgacctcgacatcgac tccatctcgatgatgacgatcgtcgtcaacgccgaagagaagttcggtgtcacgatcccc gacgacgaggtcaagaacctcaagaccgtcggcgacgccgtcaacttcatcgtcgcgggc caggagtaa

DBGET integrated database retrieval system