KEGG   Microbacterium aurum: BOH66_12060
Entry
BOH66_12060       CDS       T04977                                 
Name
(GenBank) tRNA pseudouridine(55) synthase TruB
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
maur  Microbacterium aurum
Brite
KEGG Orthology (KO) [BR:maur00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:maur03016]
    BOH66_12060
Enzymes [BR:maur01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     BOH66_12060
Transfer RNA biogenesis [BR:maur03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    BOH66_12060
 Prokaryotic type
    BOH66_12060
SSDB
Motif
Pfam: TruB_N TruB_C TruB_C_2
Other DBs
NCBI-ProteinID: APZ34896
UniProt: A0A1P8UA00
LinkDB
Position
complement(2453917..2454921)
AA seq 334 aa
MPDASASPNGSLLVDKPQGITSHDVVARARRALGTRKIGHAGTLDPMATGLLILGVGPAT
RLLTYIVGLDKTYEATIRLGVSTDSDDADGTTTAQADAAALAAVTDERIRDGIAALTGEI
SQVPSTVSAIKIGGKRAYDLARAGEEVRLKARTVTVSRFEVRPSTSSGTGAGSAAAAGSG
SGAGSAAGAGKGTASGSRDGVIDLDVVVDCSSGTYIRALARDLGAALGIGGHLTALRRTR
IGPFGVADAATDLTGDLRLLPPADVATAVLGAFPVTADEARDLRHGKRLAGAADRLAGLP
TATPAAIDPDGRLVGIVERRGGDVKSAMNMAEDA
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgcccgacgcctccgcctcacccaacggcagtctgctggtcgacaagccgcagggcatc
acgagccacgacgtcgtcgcccgcgcgcgacgcgcgctcggcacccgcaagatcggtcac
gccggcactctcgacccgatggcgaccggcctgctcatcctcggtgtcggccctgccacg
cgcctgctgacctacatcgtggggctcgacaagacctacgaggccacgatccgcctggga
gtgtcgaccgactccgacgacgccgacggcacgacgacggcgcaggcggatgccgcggcg
ctggccgccgtgaccgacgagcgcatccgggacggcatcgcggcgctcacgggcgagatc
tcccaggttcccagcaccgtctcggcgatcaagatcggcggcaagcgggcctacgacctc
gctcgcgcgggggaggaggtgcggctgaaagcccgcaccgtcacggtgagccgcttcgag
gtgcgcccttcgacaagctcagggaccggagcgggctcagccgccgcggcgggctccggg
tccggagcgggctcagcggccggagcgggcaaagggaccgcgtcgggctcacgcgacggc
gtcatcgatctggatgtcgtggtggactgctccagcggcacctacatccgcgcgctcgcc
cgcgacctcggtgccgccctcggcatcggcggccacctcaccgccctccgccgcacccgc
atcggcccgttcggggtggccgacgccgcgaccgacctgaccggcgacctgcgcctgctg
cccccggcggacgtggcgaccgcggtgctcggcgcctttcccgtcacggcggacgaggcg
cgcgacctccgtcacggcaagcggctcgcgggtgccgccgaccgcctggccgggctgccg
acggcgacgccggcggcgatcgatccggacggccgcctcgtcggcatcgtcgagcgccgc
ggcggcgacgtcaagagcgcgatgaacatggcggaggacgcatga

DBGET integrated database retrieval system