Metarhizium acridum: 19248235 Help Entry 19248235          CDS       T03104                                  Symbol RAB7, J3458_001352 Name (RefSeq) Ras- protein Rab-7   KO K07897   Ras-related protein Rab-7A Organism maw  Metarhizium acridum Pathway maw04138   Autophagy - yeast maw04144   Endocytosis maw04145   Phagosome maw04148   Efferocytosis Brite KEGG Orthology (KO) [BR:maw00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     19248235 (RAB7)    04145 Phagosome     19248235 (RAB7)    04138 Autophagy - yeast     19248235 (RAB7)    04148 Efferocytosis     19248235 (RAB7)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:maw04131]     19248235 (RAB7)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:maw04147]     19248235 (RAB7)    04031 GTP-binding proteins [BR:maw04031]     19248235 (RAB7) Membrane trafficking [BR:maw04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     19248235 (RAB7) Exosome [BR:maw04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    19248235 (RAB7)   Exosomal proteins of other body fluids (saliva and urine)    19248235 (RAB7)   Exosomal proteins of colorectal cancer cells    19248235 (RAB7)   Exosomal proteins of bladder cancer cells    19248235 (RAB7) GTP-binding proteins [BR:maw04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     19248235 (RAB7) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 nSTAND3 AAA_16 AAA_5 PduV-EutP cobW Septin AAA_24 AAA_22 SRPRB AAA_7 MCM AAA_14 ATPase_2 NTPase_1 NB-ARC ATP-synt_ab NACHT Motif Other DBs NCBI-GeneID:  19248235 NCBI-ProteinID:  XP_065978564 LinkDB All DBs Position Unknown AA seq 205 aa AA seqDB search MSSRKKVLLKVIILGDSGVGKTSLMNQYVKKKFSASYKATIGADFLTREVMVDDRQVTMQ LWDTAGQERFQSLGVAFYRGADCCVLVYDVNNAKSFEALDSWRDEFLIQASPRDPPNFPF VVLGNKIDVEESKRVISNKRAMTFCQSKGDIPYFETSAKEAINIDQAFEVIARNALAQEE SEEFSGEFDDPINIHIDNDRDGCAC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgtcttcgcggaagaaggtcctcctcaaggttatcatccttggagatagcggtgtcggc aagacgagcttgatgaatcaatatgtcaagaagaagtttagcgcgagctacaaggctacc atcggcgccgacttcttaacacgagaggtcatggtggacgacagacaggtcacaatgcag ctttgggatactgctggacaggagcgatttcagtcgttaggagtcgcgttctaccgtggt gctgactgctgtgttctcgtctacgacgtcaacaatgccaagagcttcgaggctctcgac agctggagggacgagtttctgatccaggcctcaccacgggatccccccaactttccattt gttgttctcggtaacaagattgatgtggaggagagcaaacgagtgatttcaaacaagcgc gctatgactttttgccagtccaaaggggatatcccgtattttgagactagcgccaaggag gccatcaatattgaccaggctttcgaggtcattgcccgaaacgctctcgcacaagaagag tcggaggagtttagcggcgaattcgacgaccccatcaacatccacatcgacaacgaccgt gatggttgtgcctgttaa

DBGET integrated database retrieval system