Metarhizium acridum: 19249378 Help Entry 19249378          CDS       T03104                                  Symbol cdc42, J3458_008965 Name (RefSeq) GTPase Cdc42   KO K04393   cell division control protein 42 Organism maw  Metarhizium acridum Pathway maw04011   MAPK signaling pathway - yeast maw04144   Endocytosis maw05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:maw00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     19249378 (cdc42)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     19249378 (cdc42)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     19249378 (cdc42)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:maw04131]     19249378 (cdc42)    03036 Chromosome and associated proteins [BR:maw03036]     19249378 (cdc42)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:maw04147]     19249378 (cdc42)    04031 GTP-binding proteins [BR:maw04031]     19249378 (cdc42) Membrane trafficking [BR:maw04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     19249378 (cdc42)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     19249378 (cdc42)   Macropinocytosis    Ras GTPases     19249378 (cdc42) Chromosome and associated proteins [BR:maw03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     19249378 (cdc42) Exosome [BR:maw04147]  Exosomal proteins   Exosomal proteins of microglial cells    19249378 (cdc42)   Exosomal proteins of breast milk    19249378 (cdc42) GTP-binding proteins [BR:maw04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     19249378 (cdc42) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Motif Other DBs NCBI-GeneID:  19249378 NCBI-ProteinID:  XP_007811407 UniProt:  E9E598 W8SR41 LinkDB All DBs Position Unknown AA seq 195 aa AA seqDB search MAVVATIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGDEPYTLGLFD TAGQEDYDRLRPLSYPQTDVFLVCFSVTSPASFENVREKWFPEVHHHCPGVPCLIVGTQV DLRDDPSVKEKLMKQKMTPVRREDGERMAKELHAVKYVECSALTQFKLKDVFDEAIVAAL EPPMPKKKSHKCLIL NT seq 588 nt NT seq  +upstreamnt  +downstreamnt atggccgtcgtcgcaaccatcaaatgcgttgtcgtcggcgacggtgctgttggcaagacg tgccttctcatcagctacaccaccaacaaattcccctccgaatatgttccgacggtcttt gataactatgccgttacggtaatgatcggcgacgaaccctataccctcggcctattcgat accgccggtcaagaagattacgacagactgcgacctctctcataccctcagaccgacgtc ttcctcgtctgctttagcgttacgtcgcctgcttcgtttgaaaacgttcgcgaaaaatgg tttcccgaggttcaccaccactgccctggtgttccctgcctcattgttggcacccaggtc gacttaagagacgatcccagcgtcaaagaaaagctcatgaagcagaagatgacgcctgtt aggagagaagacggcgagcgcatggctaaggagctgcacgccgtcaagtatgtcgaatgc agtgcgcttacgcaattcaagctgaaggatgtgtttgatgaggccatcgtcgccgcctta gaaccaccgatgcccaaaaagaaatctcacaaatgtctaatcctttaa

DBGET integrated database retrieval system