Metarhizium acridum: 19251893 Help Entry 19251893          CDS       T03104                                  Symbol RAC1, J3458_009201 Name (RefSeq) Rho GTPase protein rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism maw  Metarhizium acridum Pathway maw04145   Phagosome maw04148   Efferocytosis maw04620   Toll-like receptor signaling pathway maw05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:maw00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     19251893 (RAC1)    04148 Efferocytosis     19251893 (RAC1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     19251893 (RAC1)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     19251893 (RAC1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:maw04131]     19251893 (RAC1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:maw04147]     19251893 (RAC1)    04031 GTP-binding proteins [BR:maw04031]     19251893 (RAC1) Membrane trafficking [BR:maw04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     19251893 (RAC1)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     19251893 (RAC1)   Macropinocytosis    Ras GTPases     19251893 (RAC1)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     19251893 (RAC1) Exosome [BR:maw04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    19251893 (RAC1)   Exosomal proteins of other body fluids (saliva and urine)    19251893 (RAC1)   Exosomal proteins of colorectal cancer cells    19251893 (RAC1)   Exosomal proteins of bladder cancer cells    19251893 (RAC1) GTP-binding proteins [BR:maw04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     19251893 (RAC1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Motif Other DBs NCBI-GeneID:  19251893 NCBI-ProteinID:  XP_065975427 LinkDB All DBs Position Unknown AA seq 218 aa AA seqDB search MAQPNVQSLKCVVTGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYTTSLMVDGKPISLGL WDTAGQEDYDRLRPLSYPQTDVFLLCFSLINPASFDNVRSKWYPEIDHHAPNIPIILVGT KLDLKEEYDRREEAEKNGDRHAFDNASKEVKELKEKKRQRPIEFRDGLACAREIGAYKYL VCSALTQSNLKGVFDEAIRAVLNPRPPPKAKKSKCIVL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atggctcagcccaatgttcaatccttgaagtgcgtcgtgaccggtgacggtgctgttggc aagacatgtcttctcatttcatacacgacaaatgccttccccggcgagtacattcctaca gtttttgataactatacgacgagtttaatggtcgacggcaagcccatcagcctgggactg tgggatacggctggccaggaagactacgatcggttgcggccgctgtcatacccccaaacc gatgtattcctgctttgcttttctctcataaatccggcctcgtttgacaacgtccggtcc aagtggtaccccgagattgatcaccacgctcctaatatccctatcatcctggtcggtacc aaacttgatttgaaagaagagtacgacagaagagaggaggccgaaaagaacggagacaga catgcattcgataacgcctcaaaggaagtaaaagaactgaaagagaagaagagacagcga ccgatagaatttcgggatggattggcttgtgcacgagaaattggggcgtacaaatacctc gtgtgctccgcgctgacccaaagcaacctgaaaggcgtgtttgatgaagctattcgtgct gttttgaatccgcggccgccacccaaggccaagaagtctaaatgcatcgttttgtaa

DBGET integrated database retrieval system