Metarhizium acridum: 90963868 Help Entry 90963868          CDS       T03104                                  Symbol DYN2, J3458_019967 Name (RefSeq) Dynein light chain   KO K10418   dynein light chain LC8-type Organism maw  Metarhizium acridum Pathway maw04814   Motor proteins Brite KEGG Orthology (KO) [BR:maw00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     90963868 (DYN2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:maw03037]     90963868 (DYN2)    04812 Cytoskeleton proteins [BR:maw04812]     90963868 (DYN2) Cilium and associated proteins [BR:maw03037]  Motile cilia and associated proteins   Dynein arm    90963868 (DYN2) Cytoskeleton proteins [BR:maw04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      90963868 (DYN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light SGTA_dimer RhoGEF67_u1 Motif Other DBs NCBI-GeneID:  90963868 NCBI-ProteinID:  XP_065973401 LinkDB All DBs Position Unknown AA seq 100 aa AA seqDB search MADKQAETPASREKLEAQIKSADMTEDMQQESIEVAQEAMSKFTIEKDIAQHIKRTFDER KGPTWHCIVGRNFGSFVTHETKHFIYFYLGHCAILLFKTQ NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggcggacaagcaggcagaaactcccgcttcccgggagaagcttgaagcccagatcaag tccgccgatatgaccgaggacatgcagcaagagtcgatcgaagtcgcccaggaggccatg tccaaattcaccattgaaaaagacattgcccaacacatcaagcgcacattcgacgagcga aagggcccgacttggcactgcattgtcggccgcaactttggcagcttcgtaacccacgaa actaaacactttatctacttctacctcggccactgtgccatcctcctcttcaagacgcaa taa

DBGET integrated database retrieval system