Metarhizium acridum: MAC_03215 Help Entry MAC_03215         CDS       T03104                                  Name (RefSeq) nucleosome binding protein   KO K27246   non-histone chromosomal protein 6 Organism maw  Metarhizium acridum Brite KEGG Orthology (KO) [BR:maw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:maw03036]     MAC_03215 Chromosome and associated proteins [BR:maw03036]  Eukaryotic type   Nucleosome assembly factors    Histone chaperones     FACT complex      MAC_03215 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HMG_box HMG_box_2 Ccdc124 HMG_box_5 Motif Other DBs NCBI-GeneID:  19247526 NCBI-ProteinID:  XP_007809555 UniProt:  E9E017 LinkDB All DBs Position Unknown AA seq 92 aa AA seqDB search MPKVKRGKKDDGKKKRGPKRGLSAYMFFANEQRENVRAENPNITFGQVGKVLGERWKALN DKQRAPYEAKAAADKKRYEDEKAAFQAEDDSN NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcctaaggttaagcgcggcaagaaggacgatggcaagaagaagcgcggccccaagcgt ggtctgtctgcttacatgttcttcgccaatgagcagcgcgagaacgtccgtgctgagaac cccaacatcaccttcggccaggttggcaaggttcttggtgagcgctggaaggccttgaac gacaagcagcgtgctccttacgaggccaaggctgccgccgataagaaacggtatgaggac gagaaggccgctttccaggccgaggatgactctaactaa

DBGET integrated database retrieval system