Methanomethylophilus alvi: MMALV_04410 Help Entry MMALV_04410       CDS       T02624                                  Name (GenBank) SSU ribosomal protein S27Ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism max  Methanomethylophilus alvi Pathway max03010   Ribosome Brite KEGG Orthology (KO) [BR:max00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MMALV_04410   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MMALV_04410  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:max03011]     MMALV_04410    04121 Ubiquitin system [BR:max04121]     MMALV_04410   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:max04147]     MMALV_04410 Ribosome [BR:max03011]  Ribosomal proteins   Eukaryotes    Small subunit     MMALV_04410   Archaea     MMALV_04410 Ubiquitin system [BR:max04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MMALV_04410 Exosome [BR:max04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MMALV_04410   Exosomal proteins of colorectal cancer cells    MMALV_04410 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e Zn_ribbon_13 Cas12f1-like_TNB Phage_zn_bind_2 DUF1451 Zn_ribbon_Nudix DUF1936 Zn_ribbon_IS1595 Zn_ribbon_RPB9 Zf_1st_IFT121 Motif Other DBs NCBI-ProteinID:  AGI85184 UniProt:  M9SBL1 LinkDB All DBs Position 401730..401918 Genome browser AA seq 62 aa AA seqDB search MAKKEAAPKKEASKRDAYTVEGDKLVRTKPVCPKCGPGVFMAVHKDRVSCGKCGYTEFNK KE NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atggcaaagaaagaagcagcacccaagaaagaagcatcgaagagggacgcatacaccgta gagggcgacaaactcgtcaggaccaagcccgtctgccccaagtgcggacccggtgtattc atggcagtccacaaggaccgtgtttcctgcggaaagtgcggatacacagaattcaacaag aaagagtga

DBGET integrated database retrieval system