Methanomethylophilus alvi: MMALV_04770 Help Entry MMALV_04770       CDS       T02624                                  Name (GenBank) LSU ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism max  Methanomethylophilus alvi Pathway max03010   Ribosome Brite KEGG Orthology (KO) [BR:max00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MMALV_04770   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MMALV_04770  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:max03011]     MMALV_04770    04121 Ubiquitin system [BR:max04121]     MMALV_04770 Ribosome [BR:max03011]  Ribosomal proteins   Eukaryotes    Large subunit     MMALV_04770   Archaea     MMALV_04770 Ubiquitin system [BR:max04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MMALV_04770 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 DZR Toxin_5 Zn_ribbon_RPAB4 DZR_2 zf-ChsH2 Zn_ribbon_ZPR1 Motif Other DBs NCBI-ProteinID:  AGI85219 UniProt:  M9SBP4 LinkDB All DBs Position 433042..433191 Genome browser AA seq 49 aa AA seqDB search MARFKEAEHRLLDKSVCMNCYATNPLKATKCRKCGYSNLRPKAKESRKQ NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggcccgtttcaaagaggctgagcacaggctccttgacaagtccgtctgcatgaactgc tatgcgacgaacccgctcaaggcgaccaagtgccgcaaatgcggatacagcaacctgagg ccgaaggcaaaagagagcaggaagcagtaa

DBGET integrated database retrieval system