Microbacterium azadirachtae: NFX31_09400 Help Entry NFX31_09400       CDS       T08922                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism maza  Microbacterium azadirachtae Pathway maza01100   Metabolic pathways maza01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:maza00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NFX31_09400    00074 Mycolic acid biosynthesis     NFX31_09400   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NFX31_09400 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  UXW84466 LinkDB All DBs Position 1972135..1972383 Genome browser AA seq 82 aa AA seqDB search MAFSNDEVLAGLAELITDETGIDASEVALEKSFTDDLDIDSISMMTIVVNAEEKFGVTIP DDEVKNLKTVGDAVNFIVAGQE NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggctttcagcaacgacgaggtcctcgccggcctggcagagctcatcaccgacgagacc ggcatcgacgcctcggaggtcgccctggagaagtccttcacggacgacctggacatcgac tcgatctcgatgatgacgatcgtcgtcaacgccgaggagaagttcggcgtcacgatcccc gacgacgaggtgaagaacctcaagaccgtcggggacgccgtgaacttcatcgtcgccggc caggagtga

DBGET integrated database retrieval system