Methanosarcina barkeri Fusaro: Mbar_A0281 Help Entry Mbar_A0281        CDS       T00271                                  Name (GenBank) SSU ribosomal protein S27AE   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mba  Methanosarcina barkeri Fusaro Pathway mba03010   Ribosome Brite KEGG Orthology (KO) [BR:mba00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Mbar_A0281   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Mbar_A0281  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mba03011]     Mbar_A0281    04121 Ubiquitin system [BR:mba04121]     Mbar_A0281   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mba04147]     Mbar_A0281 Ribosome [BR:mba03011]  Ribosomal proteins   Eukaryotes    Small subunit     Mbar_A0281   Archaea     Mbar_A0281 Ubiquitin system [BR:mba04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Mbar_A0281 Exosome [BR:mba04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Mbar_A0281   Exosomal proteins of colorectal cancer cells    Mbar_A0281 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e Zn_ribbon_Nudix Rcat_RNF216 Zn_Ribbon_TF Zn_Ribbon_1 IBR_1 Cas12f1-like_TNB DUF6671 Zn_ribbon_13 Zn_ribbon_NUD DUF1451 Zn_ribbon_NOB1 Zn_ribbon_IS1595 Lar_restr_allev Baculo_ME53 Motif Other DBs NCBI-ProteinID:  AAZ69265 UniProt:  Q46FS7 LinkDB All DBs Position 1:complement(334010..334159) Genome browser AA seq 49 aa AA seqDB search MAVKDYYKVQGDSVTRIKQFCPRCGPGTFLADHKNRLTCGKCGYTEFKK NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggcagtaaaagattactataaagtccagggtgactccgtaaccagaatcaaacagttc tgtcccagatgtggaccaggtacattcctcgctgatcacaagaaccgcctaacttgcgga aaatgtggttataccgagtttaagaagtaa

DBGET integrated database retrieval system