Candidatus Methylopumilus turicensis: BN1209_0290 Help Entry BN1209_0290       CDS       T03844                                  Name (GenBank) Helix-turn-helix, Fis-type   KO K03557   Fis family transcriptional regulator, factor for inversion stimulation protein Organism mbac  Candidatus Methylopumilus turicensis Brite KEGG Orthology (KO) [BR:mbac00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mbac03000]     BN1209_0290    03036 Chromosome and associated proteins [BR:mbac03036]     BN1209_0290    03400 DNA repair and recombination proteins [BR:mbac03400]     BN1209_0290 Transcription factors [BR:mbac03000]  Prokaryotic type   Helix-turn-helix    Other families     BN1209_0290 Chromosome and associated proteins [BR:mbac03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     BN1209_0290 DNA repair and recombination proteins [BR:mbac03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Facilitator       BN1209_0290 SSDB OrthologParalogGFIT Motif Pfam:  HTH_8 Fis_N HTH_30 Xre-like-HTH HTH_28 HTH_50 HTH_23 UBA_At5g58720 Phage_NinH UPF0175 HTH_17 Motif Other DBs NCBI-ProteinID:  CEN55344 UniProt:  A0A0B7ISM9 LinkDB All DBs Position 1:complement(254265..254501) Genome browser AA seq 78 aa AA seqDB search MSSKCELAMSVELALNEYFKDLDGQPPHAVYDMVLACIEKPMIEHIMKRAGGNQSKAAEI LGLNRNTLRKKLQQYNIE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagttcaaaatgtgaactagcgatgagcgtggagcttgcgctcaatgagtatttcaag gatttagacggtcaaccaccgcatgcggtatatgacatggtgcttgcttgtatcgagaaa ccaatgattgagcacattatgaaacgtgctggtggcaaccaaagcaaagctgctgaaatc ttgggtttaaaccgcaacaccctcagaaaaaaattacagcaatacaatattgaataa

DBGET integrated database retrieval system