Candidatus Methylopumilus turicensis: BN1209_0550 Help Entry BN1209_0550       CDS       T03844                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism mbac  Candidatus Methylopumilus turicensis Pathway mbac01100   Metabolic pathways mbac01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mbac00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BN1209_0550 (acpP)    00074 Mycolic acid biosynthesis     BN1209_0550 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BN1209_0550 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  CEN55595 UniProt:  A0A0B7IYL5 LinkDB All DBs Position 1:complement(517083..517322) Genome browser AA seq 79 aa AA seqDB search MDTFETLREIIATKFDKPLDEITPDATFESLEIDSLDTFDIIFDAEEKFGIKVPNDEVDI KTVSDVVALLERLRAAQGQ NT seq 240 nt NT seq  +upstreamnt  +downstreamnt ttggacacctttgaaacattgcgagaaattatcgcaacgaaatttgataaaccgcttgat gaaatcacccctgatgctacttttgaatctctagaaattgattcattggatacgttcgat attatttttgatgcagaagaaaaatttggcattaaagtgccaaacgatgaagttgatatt aaaactgtcagtgatgttgttgcattgcttgagcgtcttcgcgcagcacaaggtcaataa

DBGET integrated database retrieval system