Aquirhabdus parva: HYN46_03935 Help Entry HYN46_03935       CDS       T05575                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mbah  Aquirhabdus parva Pathway mbah01100   Metabolic pathways mbah01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mbah00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HYN46_03935    00074 Mycolic acid biosynthesis     HYN46_03935   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HYN46_03935 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 Motif Other DBs NCBI-ProteinID:  AXI02081 UniProt:  A0A345P472 LinkDB All DBs Position 891024..891260 Genome browser AA seq 78 aa AA seqDB search MSDVEQRVKAAVAEQLGIRVEEIKNEASFMDDLGADSLDLVELVMSFENDFNITIPDEDS SVITTVQSAIDYVTAKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt gtgagcgatgtcgaacaacgtgtcaaggctgccgtagcagaacaactcggaatccgtgtt gaagaaatcaagaacgaagcatcgtttatggatgatctgggtgcagattctcttgatttg gttgagttggtcatgtcttttgagaatgatttcaatatcaccatccctgatgaagattca agcgtaatcaccactgttcaatcagcgattgattatgtgactgcaaaattagcataa

DBGET integrated database retrieval system