KEGG   Aquirhabdus parva: HYN46_10455
Entry
HYN46_10455       CDS       T05575                                 
Name
(GenBank) 50S ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
mbah  Aquirhabdus parva
Pathway
mbah03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mbah00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    HYN46_10455
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mbah03011]
    HYN46_10455
Ribosome [BR:mbah03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    HYN46_10455
  Bacteria
    HYN46_10455
  Archaea
    HYN46_10455
SSDB
Motif
Pfam: Ribosomal_L18p TGS TM1506
Other DBs
NCBI-ProteinID: AXI03222
UniProt: A0A345P7G3
LinkDB
Position
complement(2329505..2329855)
AA seq 116 aa
MNDKKQSRLRRAKSTRLHIRANGATRLCVNRTPRHIYAQIISSDGGKVLAQASTLDAELR
SGATGNIDAASKVGNLIAERAKAAGVTKVAFDRSGFKYHGRIKALADAARSGGLEF
NT seq 351 nt   +upstreamnt  +downstreamnt
atgaacgacaagaaacaatcgcgtttgcgtcgtgccaagagcactcgcttacacattcgt
gccaacggtgcgactcgtctgtgcgtaaaccgcacaccgcgtcatatctatgcgcaaatt
atttcatcagacggtggcaaggtattggcgcaagcttctacccttgatgctgagttgcgt
tcaggcgcaactggtaacatcgatgcagcaagcaaagtaggcaacctgattgctgaacgc
gctaaagcagctggtgtaactaaagtagcatttgaccgttctggttttaaatatcatggc
cgcatcaaagcgttagctgatgctgcacgtagcggcgggttggagttctaa

DBGET integrated database retrieval system