Methanosarcina barkeri 3: MSBR3_2795 Help Entry MSBR3_2795        CDS       T04533                                  Name (GenBank) SSU ribosomal protein S27Ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mbak  Methanosarcina barkeri 3 Pathway mbak03010   Ribosome Brite KEGG Orthology (KO) [BR:mbak00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MSBR3_2795   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MSBR3_2795  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mbak03011]     MSBR3_2795    04121 Ubiquitin system [BR:mbak04121]     MSBR3_2795   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mbak04147]     MSBR3_2795 Ribosome [BR:mbak03011]  Ribosomal proteins   Eukaryotes    Small subunit     MSBR3_2795   Archaea     MSBR3_2795 Ubiquitin system [BR:mbak04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MSBR3_2795 Exosome [BR:mbak04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MSBR3_2795   Exosomal proteins of colorectal cancer cells    MSBR3_2795 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_Nudix Ribosomal_L37e Rcat_RNF216 Zn_Ribbon_TF Zn_ribbon_RPB9 Zn_Ribbon_1 DUF6671 Cas12f1-like_TNB DUF1451 Zn_ribbon_NUD Lar_restr_allev Zn_ribbon_NOB1 Zn_ribbon_IS1595 Baculo_ME53 Motif Other DBs NCBI-ProteinID:  AKB83373 UniProt:  A0A0E3SP70 LinkDB All DBs Position complement(3699346..3699495) Genome browser AA seq 49 aa AA seqDB search MAVKDYYKVQGDSVTRIKQFCPRCGPGTFLADHKNRLACGKCGYTEFKK NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggcagtaaaagattactacaaagtccagggtgactccgtaaccagaatcaaacagttc tgtcccagatgcggaccaggtacattcctcgccgatcacaagaaccgccttgcctgcggg aagtgcggctataccgaatttaagaagtaa

DBGET integrated database retrieval system