Labilibaculum antarcticum: ALGA_2643 Help Entry ALGA_2643         CDS       T05376                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism mbas  Labilibaculum antarcticum Pathway mbas00020   Citrate cycle (TCA cycle) mbas00720   Other carbon fixation pathways mbas01100   Metabolic pathways mbas01110   Biosynthesis of secondary metabolites mbas01120   Microbial metabolism in diverse environments mbas01200   Carbon metabolism mbas01210   2-Oxocarboxylic acid metabolism Module mbas_M00009   Citrate cycle (TCA cycle, Krebs cycle) mbas_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:mbas00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     ALGA_2643   09102 Energy metabolism    00720 Other carbon fixation pathways     ALGA_2643 Enzymes [BR:mbas01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      ALGA_2643 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_9 Fer4_7 Fer4_2 Fer4_10 Fer4_6 Fer4_21 Fer4_16 Fer4_15 Fer4_4 Fer4_22 Fer4_13 Fer4_8 Fer4_17 Fer4_3 Fer4_ETF_QO Fer4_18 Motif Other DBs NCBI-ProteinID:  BAX80956 UniProt:  A0A1Y1CKN7 LinkDB All DBs Position 3397628..3397855 Genome browser AA seq 75 aa AA seqDB search MAKFKGAIVVDTEKCKGCGICVAACPTGVIDLARDVNGKGYHYAYMANPDACIGCSSCGL VCPDTVITVYRVKAS NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcgaaatttaaaggagctattgttgttgataccgaaaaatgcaagggttgtggcata tgtgttgctgcttgtcctacaggggttatcgatctggcaagagacgtaaatggcaaagga tatcattatgcatacatggctaatccagatgcatgtatcggttgttcaagttgcggattg gtttgtcctgataccgtaattactgtttacagggtaaaagcaagctag

DBGET integrated database retrieval system