Melittangium boletus: MEBOL_000255 Help Entry MEBOL_000255      CDS       T05066                                  Name (GenBank) primosome subunit DnaD   KO K03116   sec-independent protein translocase protein TatA Organism mbd  Melittangium boletus Pathway mbd03060   Protein export mbd03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:mbd00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     MEBOL_000255  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     MEBOL_000255  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:mbd02044]     MEBOL_000255 Secretion system [BR:mbd02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    MEBOL_000255 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  ATB26821 UniProt:  A0A250I6N3 LinkDB All DBs Position 316571..316804 Genome browser AA seq 77 aa AA seqDB search MGLKPMEIVLIMGVLLLLFGGSRLPQLGSSLGSAIRNFKRSFSTEDAPADEKKPVATLAN GGGVDKDVSARSTTQQS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgggtctgaagccgatggagattgtgttgatcatgggggtgctgctcctcctcttcggg ggctcgcgcttgccacagctcggctcttccctggggagcgccatccgcaacttcaagcgc agcttcagcaccgaggacgcgcccgccgacgagaagaagccggtggcgacgctggccaac ggcggcggcgtggacaaggacgtcagcgcccgcagcaccacccagcagagctga

DBGET integrated database retrieval system