Melittangium boletus: MEBOL_003042 Help Entry MEBOL_003042      CDS       T05066                                  Name (GenBank) hypothetical protein   KO K05553   minimal PKS acyl carrier protein Organism mbd  Melittangium boletus Pathway mbd00253   Tetracycline biosynthesis mbd01056   Biosynthesis of type II polyketide backbone mbd01100   Metabolic pathways mbd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mbd00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     MEBOL_003042    00253 Tetracycline biosynthesis     MEBOL_003042  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:mbd01004]     MEBOL_003042    01008 Polyketide biosynthesis proteins [BR:mbd01008]     MEBOL_003042 Lipid biosynthesis proteins [BR:mbd01004]  Polyketide synthase   Component type    MEBOL_003042 Polyketide biosynthesis proteins [BR:mbd01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      MEBOL_003042     Nonaketide PKS      MEBOL_003042     Decaketide PKS      MEBOL_003042 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7787 Motif Other DBs NCBI-ProteinID:  ATB29587 UniProt:  A0A250IEL6 LinkDB All DBs Position 3651821..3652087 Genome browser AA seq 88 aa AA seqDB search MRKLTIEHLNQIIHECMGEPNIVTEDGLDNTFPELGCDSLAILQVEARLTQDFGVPIQEL MFQKMTPRLALAYVNDNAANNDYIHMGV NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgcgaaaactgaccatcgaacatctgaatcagatcatccacgagtgcatgggagaaccc aacatcgtgacggaggacgggttggacaacaccttccccgagctcggctgcgattcgctc gccatcctgcaggtggaggcccggctcacccaggacttcggcgttccgatccaggagttg atgttccagaagatgacgccgcgcctggcccttgcctacgtcaacgacaacgcggccaac aacgactacatccacatgggggtctga

DBGET integrated database retrieval system