Melittangium boletus: MEBOL_004980 Help Entry MEBOL_004980      CDS       T05066                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism mbd  Melittangium boletus Brite KEGG Orthology (KO) [BR:mbd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:mbd03032]     MEBOL_004980    03036 Chromosome and associated proteins [BR:mbd03036]     MEBOL_004980    03400 DNA repair and recombination proteins [BR:mbd03400]     MEBOL_004980 DNA replication proteins [BR:mbd03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     MEBOL_004980 Chromosome and associated proteins [BR:mbd03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     MEBOL_004980 DNA repair and recombination proteins [BR:mbd03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       MEBOL_004980 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG MetW ARC6 Motif Other DBs NCBI-ProteinID:  ATB31517 UniProt:  A0A250IK35 LinkDB All DBs Position complement(5997199..5997468) Genome browser AA seq 89 aa AA seqDB search MTKAELVEVVAAQSRLTKKSAAEILDIVFANIGKAVKKDQRFSYPGFGTWSVRSRKARKI RNPQTNEMMKLKASKTVGFRPAKELKNSL NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaccaaggcagagctcgtggaggtggtggcggcgcagtcgcggctgacgaagaagtcg gcggcggagattctcgacatcgtcttcgccaacatcggcaaggcggtgaagaaggaccag cgcttcagctaccccggctttggcacctggtcggtccgctcgcgcaaggcgcggaagatc cgcaacccccagaccaacgagatgatgaagctcaaggcgagcaagaccgtgggtttccgg cccgccaaggagctgaagaactcgctgtag

DBGET integrated database retrieval system