Melittangium boletus: MEBOL_005876 Help Entry MEBOL_005876      CDS       T05066                                  Name (GenBank) glutaredoxin   KO K03676   glutaredoxin 3 Organism mbd  Melittangium boletus Brite KEGG Orthology (KO) [BR:mbd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:mbd03110]     MEBOL_005876 Chaperones and folding catalysts [BR:mbd03110]  Protein folding catalysts   Protein disulfide isomerase    MEBOL_005876 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Glrx-like SH3BGR GST_N_2 SSXRD GST_N Motif Other DBs NCBI-ProteinID:  ATB32398 UniProt:  A0A250IMA7 LinkDB All DBs Position complement(7081025..7081282) Genome browser AA seq 85 aa AA seqDB search MKPVKIYTTTYCGYCVRAKDLLKRKGVSYEEVDVTGDDTARAKLVEMSGGQRTVPQIFIG DTHVGGYTDLAQLDRDKKLDSMLQA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt gtgaaacccgtgaagatctacaccaccacctactgtggctactgcgtccgggccaaggat ctgctcaagcgcaagggcgtgtcctacgaggaagtggacgtgactggtgacgacaccgca cgcgcgaaactggtggagatgagcggcggacagcgcaccgtgccgcagatcttcatcggc gacacccacgtcggcggctacacggacctggctcagctggatcgggacaagaagctcgac tccatgctccaggcctga

DBGET integrated database retrieval system