KEGG   Drepanopeziza brunnea: MBM_02275
Entry
MBM_02275         CDS       T03105                                 
Name
(RefSeq) hypothetical protein
  KO
K27383  non-classical export protein 1
Organism
mbe  Drepanopeziza brunnea
Brite
KEGG Orthology (KO) [BR:mbe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mbe02000]
    MBM_02275
Transporters [BR:mbe02000]
 Other transporters
  Others
   MBM_02275
SSDB
Motif
Pfam: NCE101
Other DBs
NCBI-GeneID: 18758210
NCBI-ProteinID: XP_007290164
UniProt: K1XDU8
LinkDB
Position
Unknown
AA seq 83 aa
MPPAAAAAAPAHLISRVGDPLFALFIGLGAAATRVNREEKEAGRSTRETLDAGLRRMGFL
RREEGVFEGQGKGKEKGSGNGER
NT seq 252 nt   +upstreamnt  +downstreamnt
atgccgccagcagcagcagcagcagcaccagcgcacctcatctcccgcgtcggcgacccc
ctcttcgcgctgttcatcggcctcggcgccgccgccacgcgcgtcaatagggaggagaag
gaggccgggaggagtacgcgggagacgctcgatgcggggcttcggagaatgggatttctg
cgtcgagaggagggggtttttgagggccaggggaaggggaaggagaagggaagtggaaat
ggggagagatga

DBGET integrated database retrieval system