Drepanopeziza brunnea: MBM_03196
Help
Entry
MBM_03196 CDS
T03105
Name
(RefSeq) hypothetical protein
KO
K17795
mitochondrial import inner membrane translocase subunit TIM17
Organism
mbe
Drepanopeziza brunnea
Brite
KEGG Orthology (KO) [BR:
mbe00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03029 Mitochondrial biogenesis [BR:
mbe03029
]
MBM_03196
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
mbe02000
]
MBM_03196
Mitochondrial biogenesis [BR:
mbe03029
]
Mitochondrial protein import machinery
Inner mambrane
TIM23 complex
MBM_03196
Transporters [BR:
mbe02000
]
Other transporters
Primary active transporters [TC:
3
]
MBM_03196
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Tim17
HATPase_c_4
Motif
Other DBs
NCBI-GeneID:
18759131
NCBI-ProteinID:
XP_007291085
UniProt:
K1Y1D7
LinkDB
All DBs
Position
Unknown
AA seq
159 aa
AA seq
DB search
MDHTRDPCPWVALNDFGGAFCMGAIGGAVWHGVKGFRNSPYGERRIGALTAIKARAPVLG
GNFGVWGGLFSTFDCAVKGVRKKEDPYNAIIAGFFTGGALAVRGGYKAARNSAIGCACLL
AVIEGVGIGFQRMMAENTRLEVPQPPPAETGATGFPAVA
NT seq
480 nt
NT seq
+upstream
nt +downstream
nt
atggaccatacacgagatccatgcccttgggtggcactgaatgattttgggggagctttc
tgcatgggggcaataggaggagcagtgtggcacggcgtgaaaggctttagaaattcccct
tacggcgagagacggatcggtgctctcacagcgatcaaagcgcgagcaccggtgttaggg
ggcaactttggggtttggggggggctgttctcgacgtttgactgcgccgtgaagggagta
aggaagaaggaggatccgtataatgccatcatcgcaggattcttcactggtggcgcgctt
gccgttcgaggaggttacaaggctgcgaggaactcagcgataggatgtgcctgtctactg
gcagttattgaaggtgtgggaattgggtttcagagaatgatggctgagaacacgcgacta
gaggtaccacaacctccacccgccgagactggtgccaccggtttcccagctgtagcataa
DBGET
integrated database retrieval system