Drepanopeziza brunnea: MBM_03677 Help Entry MBM_03677         CDS       T03105                                  Name (RefSeq) SCF complex subunit Skp1   KO K03094   S-phase kinase-associated protein 1 Organism mbe  Drepanopeziza brunnea Pathway mbe03083   Polycomb repressive complex mbe04111   Cell cycle - yeast mbe04120   Ubiquitin mediated proteolysis mbe04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mbe00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     MBM_03677    04120 Ubiquitin mediated proteolysis     MBM_03677   09126 Chromosome    03083 Polycomb repressive complex     MBM_03677  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     MBM_03677  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mbe04131]     MBM_03677    04121 Ubiquitin system [BR:mbe04121]     MBM_03677    03036 Chromosome and associated proteins [BR:mbe03036]     MBM_03677 Membrane trafficking [BR:mbe04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     MBM_03677 Ubiquitin system [BR:mbe04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      MBM_03677    Cul7 complex      MBM_03677 Chromosome and associated proteins [BR:mbe03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      MBM_03677   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      MBM_03677 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Trnau1ap Motif Other DBs NCBI-GeneID:  18759612 NCBI-ProteinID:  XP_007291566 UniProt:  K1WJN3 LinkDB All DBs Position Unknown AA seq 165 aa AA seqDB search MSDTSKITLVSNDGCHIAVDRLVAEKSMLIKNMIEDLGDAALDTDVPIPNVNEAVLKKVI EWCEHHKGDAAATSDDDSDSRKKTTDIEEWDQKFMQVDQEMLFEIILASNYLDIKPLLDV GCKTVANMIKGKSPEEIRKTFNITNDFTPEEEEQIRRENEWAEDR NT seq 498 nt NT seq  +upstreamnt  +downstreamnt atgtctgacacttctaaaatcacgctcgtctctaatgacggctgccacatcgccgtcgat cgcctggtcgctgagaaatccatgctcatcaagaacatgatcgaggatctcggagatgct gccctcgataccgatgtccccatccccaacgtcaacgaagccgtccttaagaaggtcatt gagtggtgtgagcatcacaagggcgacgccgctgctacctccgacgacgactccgattct cgcaagaagaccaccgatatcgaggagtgggaccaaaaattcatgcaggtcgaccaggag atgctgttcgagatcatcttggcttccaactaccttgacattaagcccctccttgacgtt ggatgtaagaccgtcgccaacatgatcaagggcaagtcgccagaggagatccgcaagacg ttcaacatcaccaacgacttcacacccgaagaggaggagcaaatccgccgcgagaacgag tgggctgaggatcgctga

DBGET integrated database retrieval system