Drepanopeziza brunnea: MBM_04474 Help Entry MBM_04474         CDS       T03105                                  Name (RefSeq) GTPase CDC42   KO K04393   cell division control protein 42 Organism mbe  Drepanopeziza brunnea Pathway mbe04011   MAPK signaling pathway - yeast mbe04144   Endocytosis mbe04517   IgSF CAM signaling mbe04518   Integrin signaling mbe05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:mbe00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     MBM_04474   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     MBM_04474    04518 Integrin signaling     MBM_04474  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     MBM_04474  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     MBM_04474  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mbe04131]     MBM_04474    03036 Chromosome and associated proteins [BR:mbe03036]     MBM_04474   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mbe04147]     MBM_04474    04031 GTP-binding proteins [BR:mbe04031]     MBM_04474 Membrane trafficking [BR:mbe04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     MBM_04474  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     MBM_04474   Macropinocytosis    Ras GTPases     MBM_04474 Chromosome and associated proteins [BR:mbe03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     MBM_04474 Exosome [BR:mbe04147]  Exosomal proteins   Exosomal proteins of microglial cells    MBM_04474   Exosomal proteins of breast milk    MBM_04474 GTP-binding proteins [BR:mbe04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     MBM_04474 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Motif Other DBs NCBI-GeneID:  18760409 NCBI-ProteinID:  XP_007292363 UniProt:  K1XA77 LinkDB All DBs Position Unknown AA seq 194 aa AA seqDB search MVVATIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGDEPYTLGLFDT AGQEDYDRLRPLSYPQTDVFLVCFSVTSPASFENVREKWFPEVHHHCPGVPCLIVGTQTD LRDDASVREKLGKQKMSPVKREDGERMAKDLGAVKYVECSALTQYKLKDVFDEAIVAALE PPAPKKKHSKCLIL NT seq 585 nt NT seq  +upstreamnt  +downstreamnt atggtcgtcgcaacaataaagtgtgtagtagttggtgacggtgccgtgggcaagacatgt cttctcatcagctatacgacaaacaagttcccttctgaatacgtgccgaccgttttcgat aactatgccgttactgttatgattggcgatgagccatacaccttaggcctcttcgatacg gctggacaagaagattacgaccgcctacgtcccttatcttacccgcaaacggatgtcttc ctcgtctgcttctctgttacctcgcccgcgtctttcgaaaacgtccgcgagaaatggttc cccgaggtgcaccatcactgccccggcgttccttgcctcatcgtaggcacccagacggat ttgcgagatgacgcaagtgtacgggagaagctagggaagcagaagatgagcccggtcaag agggaagatggtgagaggatggccaaggatttgggtgcagtgaaatatgtggagtgcagt gcgttgacgcagtataagctgaaggatgtctttgacgaggcaattgtcgccgcgctcgaa cccccagccccaaagaaaaagcatagcaaatgcttgatcttgtaa

DBGET integrated database retrieval system