Drepanopeziza brunnea: MBM_05097 Help Entry MBM_05097         CDS       T03105                                  Name (RefSeq) GTPase rho1   KO K04513   Ras homolog gene family, member A Organism mbe  Drepanopeziza brunnea Pathway mbe04011   MAPK signaling pathway - yeast mbe04081   Hormone signaling mbe04144   Endocytosis mbe04517   IgSF CAM signaling mbe04519   Cadherin signaling mbe05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:mbe00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     MBM_05097   09133 Signaling molecules and interaction    04081 Hormone signaling     MBM_05097    04517 IgSF CAM signaling     MBM_05097    04519 Cadherin signaling     MBM_05097  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     MBM_05097  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     MBM_05097  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mbe04131]     MBM_05097   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mbe04147]     MBM_05097    04031 GTP-binding proteins [BR:mbe04031]     MBM_05097 Membrane trafficking [BR:mbe04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     MBM_05097 Exosome [BR:mbe04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MBM_05097   Exosomal proteins of other body fluids (saliva and urine)    MBM_05097   Exosomal proteins of colorectal cancer cells    MBM_05097   Exosomal proteins of bladder cancer cells    MBM_05097 GTP-binding proteins [BR:mbe04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     MBM_05097 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf SRPRB baeRF_family3 Motif Other DBs NCBI-GeneID:  18761032 NCBI-ProteinID:  XP_007292986 UniProt:  K1X7M3 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MAEIRRKLVIVGDGACGKTCLLIVFSKGTFPEVYVPTVFENYVADVEVDTKHVELALWDT AGQEDYDRLRPLSYPDSHVILICFAVDSPDSLDNVQEKWISEVLHFCSGLPIILVGCKVD LRFDQRTIEELHKTSQKPVTPEQGEETRKKIGAYKYLECSAKTNEGVREVFEHATRAALL TKKKKEKKCIVL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atggcggagattcgcagaaagcttgtgattgttggcgacggagcctgtggaaagacctgt ctcctgattgttttctccaagggtacatttccagaggtttatgtcccaaccgtcttcgag aactacgttgccgatgtcgaggtcgatacaaagcatgttgagttagctctttgggatacg gctgggcaagaagattacgaccgactccgccctctctcgtatcccgattcgcacgtcatc ctcatttgcttcgccgtcgactccccagattcccttgacaacgtccaggagaagtggatt tccgaagttctacatttctgcagcggtctgcccatcattctagtcggttgcaaggtggat cttcgtttcgatcagaggactattgaggaactccacaagacaagccaaaagcccgttacc cccgagcagggtgaggagacccgaaaaaagattggtgcctacaagtacttggagtgttca gcaaagaccaacgagggtgtccgagaggttttcgaacatgcgacccgtgccgcactcctg accaagaagaagaaggagaagaagtgcattgttctgtaa

DBGET integrated database retrieval system