Drepanopeziza brunnea: MBM_05787 Help Entry MBM_05787         CDS       T03105                                  Name (RefSeq) putative transcription activator   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism mbe  Drepanopeziza brunnea Pathway mbe03020   RNA polymerase mbe03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:mbe00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     MBM_05787   09124 Replication and repair    03420 Nucleotide excision repair     MBM_05787  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:mbe03021]     MBM_05787    03400 DNA repair and recombination proteins [BR:mbe03400]     MBM_05787 Transcription machinery [BR:mbe03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      MBM_05787   RNA polymerase III system    RNA polymerase III      MBM_05787   RNA polymerase I system    RNA polymerase I      MBM_05787 DNA repair and recombination proteins [BR:mbe03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       MBM_05787 SSDB OrthologParalogGFIT Motif Pfam:  Zn_ribbon_RPAB4 CoiA_N Zn_ribbon_DZR_6 DZR HypA Zn_ribbon_13 Motif Other DBs NCBI-GeneID:  18761722 NCBI-ProteinID:  XP_007293676 UniProt:  K1WRW6 LinkDB All DBs Position Unknown AA seq 76 aa AA seqDB search MSREAYQVPTAVPTPGRDAYGGGLEGQGHGPAILYTCGDCSAKVPLKRGDPIRCKECGHR VLYKERTKRMVQFEAR NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgtctcgtgaagcctaccaagttcccacggcagtgcccaccccaggccgcgatgcctac ggcggtggtctcgaaggccaaggccacggcccagccatcctctacacgtgcggcgactgc agcgcgaaggtgcctctcaagagaggtgaccccattcgttgcaaggagtgtggacatcgt gttctctacaaggagcggacgaagagaatggttcagttcgaggcgagatga

DBGET integrated database retrieval system