Drepanopeziza brunnea: MBM_07791 Help Entry MBM_07791         CDS       T03105                                  Name (RefSeq) LSM domain-containing protein   KO K12624   U6 snRNA-associated Sm-like protein LSm5 Organism mbe  Drepanopeziza brunnea Pathway mbe03018   RNA degradation mbe03040   Spliceosome Brite KEGG Orthology (KO) [BR:mbe00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     MBM_07791   09123 Folding, sorting and degradation    03018 RNA degradation     MBM_07791  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mbe03019]     MBM_07791    03041 Spliceosome [BR:mbe03041]     MBM_07791 Messenger RNA biogenesis [BR:mbe03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      MBM_07791   mRNA degradation factors    5'-3' decay     Lsm complex      MBM_07791 Spliceosome [BR:mbe03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     MBM_07791 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM Motif Other DBs NCBI-GeneID:  18763726 NCBI-ProteinID:  XP_007295680 UniProt:  K1XNQ7 LinkDB All DBs Position Unknown AA seq 59 aa AA seqDB search MKGDKEFSGTLLGFDDYVNMVLEDVTEFDYSGNHTKLSKILLNGNNICMARLLTRPFER NT seq 180 nt NT seq  +upstreamnt  +downstreamnt atgaaaggcgacaaggaattcagcggcactcttctcggtttcgatgattacgtcaatatg gttctcgaggatgtgactgaattcgactactctggcaaccacaccaagctctccaagatc ctgttgaatgggaataacatctgcatggcacgtcttctcaccagaccgtttgagagatga

DBGET integrated database retrieval system