Drepanopeziza brunnea: MBM_08272 Help Entry MBM_08272         CDS       T03105                                  Name (RefSeq) ubiquitin related modifier 1   KO K12161   ubiquitin related modifier 1 Organism mbe  Drepanopeziza brunnea Pathway mbe04122   Sulfur relay system Brite KEGG Orthology (KO) [BR:mbe00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04122 Sulfur relay system     MBM_08272  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:mbe03016]     MBM_08272    04121 Ubiquitin system [BR:mbe04121]     MBM_08272 Transfer RNA biogenesis [BR:mbe03016]  Eukaryotic type   tRNA modification factors    Thiolation factors     MBM_08272 Ubiquitin system [BR:mbe04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    MBM_08272 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Urm1 ThiS DUF6189 Motif Other DBs NCBI-GeneID:  18764207 NCBI-ProteinID:  XP_007296161 UniProt:  K1XM57 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MASQPLISLVVEFSGGLEMLFSDERQHKLQVPATDEKGNAVTVGWLVNYLCEELMKDARK EMFILDGHVRPGILVLINDADWELEGEATYALQHNDNILFVSTLHGG NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggcttctcaaccccttatttctcttgttgtcgagttctccggtggcctggagatgctc ttctccgatgagcgtcagcacaagctccaggtccctgccacagacgaaaagggaaacgcc gtcaccgtcggatggctcgtcaactatctctgcgaggagctcatgaaagatgcaaggaag gagatgttcatactggatggtcacgtccgcccgggaatcctggtactgatcaacgatgcc gactgggagttagagggcgaagctacttacgccctgcaacacaatgacaatattctcttc gtctcaactctacatggaggctaa

DBGET integrated database retrieval system