KEGG   Moschus berezovskii (Chinese forest musk deer): 129542485
Entry
129542485         CDS       T09065                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mbez  Moschus berezovskii (Chinese forest musk deer)
Pathway
mbez01521  EGFR tyrosine kinase inhibitor resistance
mbez01522  Endocrine resistance
mbez01524  Platinum drug resistance
mbez04010  MAPK signaling pathway
mbez04012  ErbB signaling pathway
mbez04014  Ras signaling pathway
mbez04015  Rap1 signaling pathway
mbez04022  cGMP-PKG signaling pathway
mbez04024  cAMP signaling pathway
mbez04062  Chemokine signaling pathway
mbez04066  HIF-1 signaling pathway
mbez04068  FoxO signaling pathway
mbez04071  Sphingolipid signaling pathway
mbez04072  Phospholipase D signaling pathway
mbez04114  Oocyte meiosis
mbez04140  Autophagy - animal
mbez04148  Efferocytosis
mbez04150  mTOR signaling pathway
mbez04151  PI3K-Akt signaling pathway
mbez04210  Apoptosis
mbez04218  Cellular senescence
mbez04261  Adrenergic signaling in cardiomyocytes
mbez04270  Vascular smooth muscle contraction
mbez04350  TGF-beta signaling pathway
mbez04360  Axon guidance
mbez04370  VEGF signaling pathway
mbez04371  Apelin signaling pathway
mbez04380  Osteoclast differentiation
mbez04510  Focal adhesion
mbez04520  Adherens junction
mbez04540  Gap junction
mbez04550  Signaling pathways regulating pluripotency of stem cells
mbez04611  Platelet activation
mbez04613  Neutrophil extracellular trap formation
mbez04620  Toll-like receptor signaling pathway
mbez04621  NOD-like receptor signaling pathway
mbez04625  C-type lectin receptor signaling pathway
mbez04650  Natural killer cell mediated cytotoxicity
mbez04657  IL-17 signaling pathway
mbez04658  Th1 and Th2 cell differentiation
mbez04659  Th17 cell differentiation
mbez04660  T cell receptor signaling pathway
mbez04662  B cell receptor signaling pathway
mbez04664  Fc epsilon RI signaling pathway
mbez04666  Fc gamma R-mediated phagocytosis
mbez04668  TNF signaling pathway
mbez04713  Circadian entrainment
mbez04720  Long-term potentiation
mbez04722  Neurotrophin signaling pathway
mbez04723  Retrograde endocannabinoid signaling
mbez04724  Glutamatergic synapse
mbez04725  Cholinergic synapse
mbez04726  Serotonergic synapse
mbez04730  Long-term depression
mbez04810  Regulation of actin cytoskeleton
mbez04910  Insulin signaling pathway
mbez04912  GnRH signaling pathway
mbez04914  Progesterone-mediated oocyte maturation
mbez04915  Estrogen signaling pathway
mbez04916  Melanogenesis
mbez04917  Prolactin signaling pathway
mbez04919  Thyroid hormone signaling pathway
mbez04921  Oxytocin signaling pathway
mbez04926  Relaxin signaling pathway
mbez04928  Parathyroid hormone synthesis, secretion and action
mbez04929  GnRH secretion
mbez04930  Type II diabetes mellitus
mbez04933  AGE-RAGE signaling pathway in diabetic complications
mbez04934  Cushing syndrome
mbez04935  Growth hormone synthesis, secretion and action
mbez04960  Aldosterone-regulated sodium reabsorption
mbez05010  Alzheimer disease
mbez05020  Prion disease
mbez05022  Pathways of neurodegeneration - multiple diseases
mbez05034  Alcoholism
mbez05132  Salmonella infection
mbez05133  Pertussis
mbez05135  Yersinia infection
mbez05140  Leishmaniasis
mbez05142  Chagas disease
mbez05145  Toxoplasmosis
mbez05152  Tuberculosis
mbez05160  Hepatitis C
mbez05161  Hepatitis B
mbez05163  Human cytomegalovirus infection
mbez05164  Influenza A
mbez05165  Human papillomavirus infection
mbez05166  Human T-cell leukemia virus 1 infection
mbez05167  Kaposi sarcoma-associated herpesvirus infection
mbez05170  Human immunodeficiency virus 1 infection
mbez05171  Coronavirus disease - COVID-19
mbez05200  Pathways in cancer
mbez05203  Viral carcinogenesis
mbez05205  Proteoglycans in cancer
mbez05206  MicroRNAs in cancer
mbez05207  Chemical carcinogenesis - receptor activation
mbez05208  Chemical carcinogenesis - reactive oxygen species
mbez05210  Colorectal cancer
mbez05211  Renal cell carcinoma
mbez05212  Pancreatic cancer
mbez05213  Endometrial cancer
mbez05214  Glioma
mbez05215  Prostate cancer
mbez05216  Thyroid cancer
mbez05218  Melanoma
mbez05219  Bladder cancer
mbez05220  Chronic myeloid leukemia
mbez05221  Acute myeloid leukemia
mbez05223  Non-small cell lung cancer
mbez05224  Breast cancer
mbez05225  Hepatocellular carcinoma
mbez05226  Gastric cancer
mbez05230  Central carbon metabolism in cancer
mbez05231  Choline metabolism in cancer
mbez05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mbez05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mbez00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    129542485 (MAPK1)
   04012 ErbB signaling pathway
    129542485 (MAPK1)
   04014 Ras signaling pathway
    129542485 (MAPK1)
   04015 Rap1 signaling pathway
    129542485 (MAPK1)
   04350 TGF-beta signaling pathway
    129542485 (MAPK1)
   04370 VEGF signaling pathway
    129542485 (MAPK1)
   04371 Apelin signaling pathway
    129542485 (MAPK1)
   04668 TNF signaling pathway
    129542485 (MAPK1)
   04066 HIF-1 signaling pathway
    129542485 (MAPK1)
   04068 FoxO signaling pathway
    129542485 (MAPK1)
   04072 Phospholipase D signaling pathway
    129542485 (MAPK1)
   04071 Sphingolipid signaling pathway
    129542485 (MAPK1)
   04024 cAMP signaling pathway
    129542485 (MAPK1)
   04022 cGMP-PKG signaling pathway
    129542485 (MAPK1)
   04151 PI3K-Akt signaling pathway
    129542485 (MAPK1)
   04150 mTOR signaling pathway
    129542485 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    129542485 (MAPK1)
   04148 Efferocytosis
    129542485 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    129542485 (MAPK1)
   04210 Apoptosis
    129542485 (MAPK1)
   04218 Cellular senescence
    129542485 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    129542485 (MAPK1)
   04520 Adherens junction
    129542485 (MAPK1)
   04540 Gap junction
    129542485 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    129542485 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    129542485 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    129542485 (MAPK1)
   04613 Neutrophil extracellular trap formation
    129542485 (MAPK1)
   04620 Toll-like receptor signaling pathway
    129542485 (MAPK1)
   04621 NOD-like receptor signaling pathway
    129542485 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    129542485 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    129542485 (MAPK1)
   04660 T cell receptor signaling pathway
    129542485 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    129542485 (MAPK1)
   04659 Th17 cell differentiation
    129542485 (MAPK1)
   04657 IL-17 signaling pathway
    129542485 (MAPK1)
   04662 B cell receptor signaling pathway
    129542485 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    129542485 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    129542485 (MAPK1)
   04062 Chemokine signaling pathway
    129542485 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    129542485 (MAPK1)
   04929 GnRH secretion
    129542485 (MAPK1)
   04912 GnRH signaling pathway
    129542485 (MAPK1)
   04915 Estrogen signaling pathway
    129542485 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    129542485 (MAPK1)
   04917 Prolactin signaling pathway
    129542485 (MAPK1)
   04921 Oxytocin signaling pathway
    129542485 (MAPK1)
   04926 Relaxin signaling pathway
    129542485 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    129542485 (MAPK1)
   04919 Thyroid hormone signaling pathway
    129542485 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    129542485 (MAPK1)
   04916 Melanogenesis
    129542485 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    129542485 (MAPK1)
   04270 Vascular smooth muscle contraction
    129542485 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    129542485 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    129542485 (MAPK1)
   04725 Cholinergic synapse
    129542485 (MAPK1)
   04726 Serotonergic synapse
    129542485 (MAPK1)
   04720 Long-term potentiation
    129542485 (MAPK1)
   04730 Long-term depression
    129542485 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    129542485 (MAPK1)
   04722 Neurotrophin signaling pathway
    129542485 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    129542485 (MAPK1)
   04380 Osteoclast differentiation
    129542485 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    129542485 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    129542485 (MAPK1)
   05206 MicroRNAs in cancer
    129542485 (MAPK1)
   05205 Proteoglycans in cancer
    129542485 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    129542485 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    129542485 (MAPK1)
   05203 Viral carcinogenesis
    129542485 (MAPK1)
   05230 Central carbon metabolism in cancer
    129542485 (MAPK1)
   05231 Choline metabolism in cancer
    129542485 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    129542485 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    129542485 (MAPK1)
   05212 Pancreatic cancer
    129542485 (MAPK1)
   05225 Hepatocellular carcinoma
    129542485 (MAPK1)
   05226 Gastric cancer
    129542485 (MAPK1)
   05214 Glioma
    129542485 (MAPK1)
   05216 Thyroid cancer
    129542485 (MAPK1)
   05221 Acute myeloid leukemia
    129542485 (MAPK1)
   05220 Chronic myeloid leukemia
    129542485 (MAPK1)
   05218 Melanoma
    129542485 (MAPK1)
   05211 Renal cell carcinoma
    129542485 (MAPK1)
   05219 Bladder cancer
    129542485 (MAPK1)
   05215 Prostate cancer
    129542485 (MAPK1)
   05213 Endometrial cancer
    129542485 (MAPK1)
   05224 Breast cancer
    129542485 (MAPK1)
   05223 Non-small cell lung cancer
    129542485 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    129542485 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    129542485 (MAPK1)
   05161 Hepatitis B
    129542485 (MAPK1)
   05160 Hepatitis C
    129542485 (MAPK1)
   05171 Coronavirus disease - COVID-19
    129542485 (MAPK1)
   05164 Influenza A
    129542485 (MAPK1)
   05163 Human cytomegalovirus infection
    129542485 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    129542485 (MAPK1)
   05165 Human papillomavirus infection
    129542485 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    129542485 (MAPK1)
   05135 Yersinia infection
    129542485 (MAPK1)
   05133 Pertussis
    129542485 (MAPK1)
   05152 Tuberculosis
    129542485 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    129542485 (MAPK1)
   05140 Leishmaniasis
    129542485 (MAPK1)
   05142 Chagas disease
    129542485 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    129542485 (MAPK1)
   05020 Prion disease
    129542485 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    129542485 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    129542485 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    129542485 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    129542485 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    129542485 (MAPK1)
   04934 Cushing syndrome
    129542485 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    129542485 (MAPK1)
   01524 Platinum drug resistance
    129542485 (MAPK1)
   01522 Endocrine resistance
    129542485 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mbez01001]
    129542485 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mbez03036]
    129542485 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mbez04147]
    129542485 (MAPK1)
Enzymes [BR:mbez01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     129542485 (MAPK1)
Protein kinases [BR:mbez01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   129542485 (MAPK1)
Chromosome and associated proteins [BR:mbez03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     129542485 (MAPK1)
Exosome [BR:mbez04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   129542485 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 129542485
NCBI-ProteinID: XP_055260934
LinkDB
Position
Unknown
AA seq 360 aa
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPVAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgac
gtggggccgcgctacaccaacctctcgtacatcggcgagggcgcctacggcatggtgtgc
tctgcttatgataatgtcaacaaagttcgagtcgctatcaagaaaatcagcccgtttgag
caccagacctactgccagaggacgctgagagagataaagatcctactgcgcttcagacac
gagaacatcatcgggatcaatgacatcatccgagcgccaaccatcgagcagatgaaagat
gtatacatagtacaggacctcatggagacggatctctacaagctcctgaagacacagcac
ctcagcaacgaccacatctgctacttcctgtaccagatcctcagagggctcaagtacatc
cactccgccaacgtgctgcaccgagacctcaaaccatccaacctgctgctgaacaccacc
tgcgatctcaagatctgtgactttggcttggcccgcgttgcagatccagaccatgaccac
acagggttcctgacagagtacgtggccactcgctggtaccgggctccagaaatcatgttg
aattccaagggctacaccaagtccatcgacatctggtccgtgggctgcatcctggcagag
atgctctccaacaggcccatcttccccgggaagcattacctcgaccagctgaaccacatt
ctgggtattcttggatccccatcgcaggaagacctgaattgtataataaatttaaaagct
agaaactatctgctgtctcttccacacaaaaataaggtgccatggaacaggctgttcccg
aacgctgactccaaagctctggatttactggacaaaatgttgacgttcaaccctcacaag
aggatcgaggtggagcaggctctggcccacccgtaccttgagcagtactacgacccgagc
gacgagcccgtcgccgaagcacccttcaagtttgacatggagttggacgacttgcccaag
gaaaagctcaaagaactcatttttgaagagactgctagattccagccgggataccgatct
taa

DBGET integrated database retrieval system