KEGG   Moschus berezovskii (Chinese forest musk deer): 129546950
Entry
129546950         CDS       T09065                                 
Symbol
PSMD7
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 7
  KO
K03038  26S proteasome regulatory subunit N8
Organism
mbez  Moschus berezovskii (Chinese forest musk deer)
Pathway
mbez03050  Proteasome
mbez05010  Alzheimer disease
mbez05012  Parkinson disease
mbez05014  Amyotrophic lateral sclerosis
mbez05016  Huntington disease
mbez05017  Spinocerebellar ataxia
mbez05020  Prion disease
mbez05022  Pathways of neurodegeneration - multiple diseases
mbez05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mbez00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    129546950 (PSMD7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    129546950 (PSMD7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    129546950 (PSMD7)
   05012 Parkinson disease
    129546950 (PSMD7)
   05014 Amyotrophic lateral sclerosis
    129546950 (PSMD7)
   05016 Huntington disease
    129546950 (PSMD7)
   05017 Spinocerebellar ataxia
    129546950 (PSMD7)
   05020 Prion disease
    129546950 (PSMD7)
   05022 Pathways of neurodegeneration - multiple diseases
    129546950 (PSMD7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mbez03051]
    129546950 (PSMD7)
Proteasome [BR:mbez03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     129546950 (PSMD7)
SSDB
Motif
Pfam: MitMem_reg JAB Connexin
Other DBs
NCBI-GeneID: 129546950
NCBI-ProteinID: XP_055268397
LinkDB
Position
Unknown
AA seq 298 aa
RIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFKK
VNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEAYISVEEV
HDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSK
LLDIRGYLEKVATGKLPINHQIIYQLQDVFNLLPDVSLQEFVKAFYLKTNDQMVVVYLAS
LIRSVVALHNLINNKIANRDAEKKEGQEKEDSKKDRKDDKEKEKEKSDVKKEEKKEKK
NT seq 897 nt   +upstreamnt  +downstreamnt
agaataggcaaggttggaaaccaaaaacgtgttgttggtgtgcttttggggtcgtggcaa
aagaaagtacttgacgtatccaacagttttgcagttccttttgatgaagacgacaaagat
gattctgtctggtttttagaccatgattacttggaaaacatgtatggaatgtttaagaag
gtcaacgccagagaaagaatagttgggtggtaccacacaggccctaaactacacaagaat
gacatcgccatcaatgaactaatgaaaagatactgccctaactcagtattggtcatcatt
gatgtgaaaccaaaggacctgggactgcccacagaagcatatatttcagtggaagaagtt
catgatgatggaactccaacctctaaaacatttgagcacgtgaccagtgaaattggagca
gaggaagctgaggaagtcggagttgaacacttgttacgagacatcaaagacactacagtg
ggcactctttcccagcggatcacaaaccaggtccatggtctgaagggactcaactccaag
ctcctggacatcaggggctacctggagaaggtggccactggcaagctgcccatcaaccac
cagatcatctaccagctgcaggacgtcttcaacctgctgccagatgtcagcctgcaggag
tttgtcaaggctttttacctgaagaccaacgatcagatggtggtggtatatttggcctca
ctgatccgttctgtggtcgccttgcacaacctcatcaacaacaagattgccaaccgggac
gcagaaaagaaagaagggcaagaaaaggaagacagcaaaaaggatagaaaagatgacaaa
gagaaagagaaggaaaagagtgatgtaaagaaagaagagaaaaaggagaaaaaataa

DBGET integrated database retrieval system