KEGG   Moschus berezovskii (Chinese forest musk deer): 129555444
Entry
129555444         CDS       T09065                                 
Name
(RefSeq) calmodulin-like
  KO
K02183  calmodulin
Organism
mbez  Moschus berezovskii (Chinese forest musk deer)
Pathway
mbez04014  Ras signaling pathway
mbez04015  Rap1 signaling pathway
mbez04020  Calcium signaling pathway
mbez04022  cGMP-PKG signaling pathway
mbez04024  cAMP signaling pathway
mbez04070  Phosphatidylinositol signaling system
mbez04114  Oocyte meiosis
mbez04218  Cellular senescence
mbez04261  Adrenergic signaling in cardiomyocytes
mbez04270  Vascular smooth muscle contraction
mbez04371  Apelin signaling pathway
mbez04625  C-type lectin receptor signaling pathway
mbez04713  Circadian entrainment
mbez04720  Long-term potentiation
mbez04722  Neurotrophin signaling pathway
mbez04728  Dopaminergic synapse
mbez04740  Olfactory transduction
mbez04744  Phototransduction
mbez04750  Inflammatory mediator regulation of TRP channels
mbez04910  Insulin signaling pathway
mbez04912  GnRH signaling pathway
mbez04915  Estrogen signaling pathway
mbez04916  Melanogenesis
mbez04921  Oxytocin signaling pathway
mbez04922  Glucagon signaling pathway
mbez04924  Renin secretion
mbez04925  Aldosterone synthesis and secretion
mbez04970  Salivary secretion
mbez04971  Gastric acid secretion
mbez05010  Alzheimer disease
mbez05012  Parkinson disease
mbez05022  Pathways of neurodegeneration - multiple diseases
mbez05031  Amphetamine addiction
mbez05034  Alcoholism
mbez05133  Pertussis
mbez05152  Tuberculosis
mbez05163  Human cytomegalovirus infection
mbez05167  Kaposi sarcoma-associated herpesvirus infection
mbez05170  Human immunodeficiency virus 1 infection
mbez05200  Pathways in cancer
mbez05214  Glioma
mbez05417  Lipid and atherosclerosis
mbez05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mbez00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    129555444
   04015 Rap1 signaling pathway
    129555444
   04371 Apelin signaling pathway
    129555444
   04020 Calcium signaling pathway
    129555444
   04070 Phosphatidylinositol signaling system
    129555444
   04024 cAMP signaling pathway
    129555444
   04022 cGMP-PKG signaling pathway
    129555444
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    129555444
   04218 Cellular senescence
    129555444
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    129555444
  09152 Endocrine system
   04910 Insulin signaling pathway
    129555444
   04922 Glucagon signaling pathway
    129555444
   04912 GnRH signaling pathway
    129555444
   04915 Estrogen signaling pathway
    129555444
   04921 Oxytocin signaling pathway
    129555444
   04916 Melanogenesis
    129555444
   04924 Renin secretion
    129555444
   04925 Aldosterone synthesis and secretion
    129555444
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    129555444
   04270 Vascular smooth muscle contraction
    129555444
  09154 Digestive system
   04970 Salivary secretion
    129555444
   04971 Gastric acid secretion
    129555444
  09156 Nervous system
   04728 Dopaminergic synapse
    129555444
   04720 Long-term potentiation
    129555444
   04722 Neurotrophin signaling pathway
    129555444
  09157 Sensory system
   04744 Phototransduction
    129555444
   04740 Olfactory transduction
    129555444
   04750 Inflammatory mediator regulation of TRP channels
    129555444
  09159 Environmental adaptation
   04713 Circadian entrainment
    129555444
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    129555444
  09162 Cancer: specific types
   05214 Glioma
    129555444
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    129555444
   05163 Human cytomegalovirus infection
    129555444
   05167 Kaposi sarcoma-associated herpesvirus infection
    129555444
  09171 Infectious disease: bacterial
   05133 Pertussis
    129555444
   05152 Tuberculosis
    129555444
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    129555444
   05012 Parkinson disease
    129555444
   05022 Pathways of neurodegeneration - multiple diseases
    129555444
  09165 Substance dependence
   05031 Amphetamine addiction
    129555444
   05034 Alcoholism
    129555444
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    129555444
   05418 Fluid shear stress and atherosclerosis
    129555444
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mbez01009]
    129555444
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mbez04131]
    129555444
   03036 Chromosome and associated proteins [BR:mbez03036]
    129555444
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mbez04147]
    129555444
Protein phosphatases and associated proteins [BR:mbez01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     129555444
Membrane trafficking [BR:mbez04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    129555444
Chromosome and associated proteins [BR:mbez03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     129555444
Exosome [BR:mbez04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   129555444
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 AIF-1 EF-hand_9 EF-hand_4 SPARC_Ca_bdg DUF5580_M EF-hand_11 Dockerin_1 vRNAP_dom ExbD HAD
Other DBs
NCBI-GeneID: 129555444
NCBI-ProteinID: XP_055280852
LinkDB
Position
Unknown
AA seq 149 aa
MAEKLSEEQVAEFKEAFDRFDKDKDGTITVQELGTVMQELCLKPSEAELKVLIARLDTDN
NGVISFQEFLEAMAAGLQTSVTEEGLRDIFRAFDQDNDGYISVDELRQATAQLGEKLSQD
ELDAMIREADVDQDGRVNYEEFVRILTQN
NT seq 450 nt   +upstreamnt  +downstreamnt
atggcagaaaagctgtccgaagagcaggtggcggagttcaaggaggccttcgacaggttc
gataaggacaaggatggcaccatcactgtgcaggagctgggcactgtgatgcaggagctg
tgcctgaagccatcagaggctgagctgaaggtgctcatcgcccggctggacacggacaac
aacggcgtcatcagcttccaggagttcctggaggccatggccgcagggcttcagacctcg
gtcacggaggagggcctgcgggatatcttccgtgcctttgaccaggacaatgatggctat
atcagtgtggacgagctcaggcaggccaccgcccagctgggggagaagctgtctcaggat
gagctggacgccatgatccgggaggcggacgtggaccaagacggccgggtgaattacgag
gagttcgtgcgcatcctcacccagaactga

DBGET integrated database retrieval system