Microbacterium binotii: LXM64_09275 Help Entry LXM64_09275       CDS       T08238                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mbin  Microbacterium binotii Pathway mbin01100   Metabolic pathways mbin01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mbin00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LXM64_09275    00074 Mycolic acid biosynthesis     LXM64_09275   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LXM64_09275 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  UIN29357 LinkDB All DBs Position 1847030..1847278 Genome browser AA seq 82 aa AA seqDB search MAFTTDEVLAGLAELITDETGISADEVALEKSFTDDLDIDSISMMTIVVNAEEKFGVTIP DDEVKNLKTVGDAVTYITSNQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggctttcaccactgacgaggtcctcgccggactcgccgagctcatcaccgacgagacc gggatctcggccgacgaggtcgcgctcgagaagtccttcaccgacgacctcgacatcgac tcgatctcgatgatgacgatcgtcgtcaacgccgaggagaagttcggcgtcaccatcccc gacgacgaggtcaagaacctcaagaccgtcggcgacgccgtcacctacatcacctcgaac caggcgtga

DBGET integrated database retrieval system