Moraxella bovoculi: AAX09_08075 Help Entry AAX09_08075       CDS       T04324                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mbl  Moraxella bovoculi Pathway mbl01100   Metabolic pathways mbl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mbl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AAX09_08075    00074 Mycolic acid biosynthesis     AAX09_08075   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AAX09_08075 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AKG19328 LinkDB All DBs Position complement(1748019..1748258) Genome browser AA seq 79 aa AA seqDB search MSDIEIEAKVKDAVAEQLGLNVADINNDASFMDDLGADSLDLVELVMAFESNFGITIPDE DSAELTTVQKAIDYVTAKL NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaaatcgaagctaaagtaaaagacgcagtggctgaacaacttggtcta aacgttgctgacatcaataatgacgcgtcattcatggacgatttaggtgcagattctcta gacctagttgagcttgtaatggcatttgaaagcaacttcggcatcactatccctgatgaa gattctgctgaacttactactgttcaaaaagcaatcgactacgtgactgctaagctttaa

DBGET integrated database retrieval system