Methanoregula boonei: Mboo_1709
Help
Entry
Mboo_1709 CDS
T00578
Name
(GenBank) anaerobic ribonucleoside-triphosphate reductase
KO
K21636
ribonucleoside-triphosphate reductase (formate) [EC:
1.1.98.6
]
Organism
mbn
Methanoregula boonei
Pathway
mbn00230
Purine metabolism
mbn00240
Pyrimidine metabolism
mbn01100
Metabolic pathways
mbn01232
Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:
mbn00001
]
09100 Metabolism
09104 Nucleotide metabolism
00230 Purine metabolism
Mboo_1709
00240 Pyrimidine metabolism
Mboo_1709
Enzymes [BR:
mbn01000
]
1. Oxidoreductases
1.1 Acting on the CH-OH group of donors
1.1.98 With other, known, physiological acceptors
1.1.98.6 ribonucleoside-triphosphate reductase (formate)
Mboo_1709
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
NRDD
ATP-cone
sCache_like
DUF2953
Motif
Other DBs
NCBI-ProteinID:
ABS56226
UniProt:
A7I915
LinkDB
All DBs
Position
1788604..1790793
Genome browser
AA seq
729 aa
AA seq
DB search
MPARRETRQLTFGGGFSPALPPVRTTDGHIVDWDRNRIAEQIKKETKLVESFYGYEGADD
ATAQEIAREVEQRILALGLKSLSGPLIREIMNITLLEKGMVQYRNVCTRVGTPVYDAHQI
DVGKGFEAHDNANLQENAETSHKKKADKISKEQYLLQLPPELADHHLCGEMHIHDLEYFG
TRPFCQDWDLRYFFYYGLMPDGNGTKASVAGPAKRAEVAILHAVKALGSAQTNFAGGQGY
YNFLTFLAPYMEGMSYDEIKQNMQMFVYEMTQMMVARGGQLVFSSVQLSPGVPTLWQDKP
CVFKGKIWDGKEAPRRTYGEFEREVRLLFKALMDVMIEGDYWGKPFNFPKPEISIEPDFT
KEREEFNRNHPDLPTFRDLYLMTFELASKFGTPYYDNQLPAYRGAGKGISCYQCCAYQFS
TVADKDSEFDKKLLFEGGRHFSMGSWQVVSVNCPRAAYNAEGKDERLFAELRALMDVAVE
LFKIKRRWMNNIRASGRMPFAMQRPKDPNTGDRGAIAVDLEGLVYTIGVVGVNEMVQHHT
GQQVHESKAAFKLAIRAMTEMELYARKLSAKNNMTIALARTPAETTGQRFAVADLIDKRY
HDMAAKVIKGDLDYALNNLGKTRDLPIYYTNGTHVAPGANVPLTKRMEIEHVFFPIVDGG
NIFHIWLGEARPDPRGLMDMAMNLCRNTQIGYFAFTRDLTVPLRQFREFRPEKRAEGSWM
PPADVPAKA
NT seq
2190 nt
NT seq
+upstream
nt +downstream
nt
atgccggcccgaagggagacccggcaactgacctttggtggcggcttttccccggccctg
cccccggtccgcacaaccgacggccacatcgttgactgggaccggaaccggatcgccgag
cagatcaaaaaggaaacaaaacttgtcgagtctttttacgggtacgagggcgcagacgac
gcaaccgcacaggagatcgcaagggaggtcgagcagcgcatccttgcgctcggcctcaag
tcactctcgggcccgctcatccgggagatcatgaatatcacgctcctcgaaaaaggcatg
gtgcagtaccgtaacgtctgcacccgggtgggaacacctgtctacgatgcgcaccagatc
gatgtgggcaagggctttgaggcccacgacaacgcgaacctccaggagaatgccgagacc
agccacaagaaaaaggcggacaagatctctaaagaacagtacctgctccagctccccccg
gagcttgccgaccatcacctgtgcggtgagatgcatatccacgatctcgaatacttcggc
acccggccgttctgccaggactgggacctgaggtatttcttttattatggcctcatgccg
gacgggaacgggacaaaggcttctgtcgccggcccggccaaacgtgcagaggtcgcaatc
ctccatgcggtaaaagcgctcgggagcgcccagaccaattttgccggcgggcagggttac
tacaacttcctcacgttcctcgcgccctacatggagggcatgagttacgacgagatcaag
cagaacatgcagatgtttgtgtacgagatgacccagatgatggtggcccggggcggccag
ctcgtcttctcatccgtccagctctcaccgggcgtcccgacgctctggcaggacaagccc
tgcgtctttaaaggaaaaatctgggacgggaaagaggccccgcgccgcacctacggagag
tttgagcgggaggtccggctgcttttcaaggcgctcatggacgtaatgatcgagggcgat
tactggggaaagccgttcaacttccccaaacccgagatctccattgagccggacttcaca
aaagagcgcgaggagttcaaccggaaccacccggatctcccgacattccgcgatctttat
ctcatgacatttgagcttgcctccaagttcgggacgccgtactacgacaaccagctcccg
gcgtaccgcggcgcaggcaaggggatctcatgctaccagtgttgcgcgtaccagttctcc
acagtggcagacaaggactcggagtttgacaaaaaactccttttcgaaggtggccggcat
ttctcgatgggctcgtggcaggtggtctcggtcaactgcccgcgtgcagcctataatgcg
gaggggaaggacgaacggctctttgctgaacttcgggcgctcatggatgtggccgtcgaa
ctcttcaagataaaacgccggtggatgaataatatccgggcgagcgggcggatgccgttt
gccatgcagcggccaaaggaccccaacaccggtgatcgcggggcaattgccgttgatctc
gaaggtcttgtgtacacgatcggtgtcgtgggggtcaacgaaatggtccagcaccacaca
ggccagcaggtccacgagtcaaaggcggcattcaaacttgccatccgcgccatgaccgag
atggaactgtatgcaaggaaactctcggcaaagaacaacatgaccatagcccttgcccgc
accccggccgagacaaccggccagcgctttgcggtcgccgatctcattgataagcggtac
cacgacatggcggcaaaggtgatcaagggcgacctcgattatgcactcaataacctggga
aagacccgcgacctcccgatttactacacgaacgggacacacgtggcaccgggcgccaat
gtcccgctcacaaaaaggatggagatcgagcatgtcttcttcccgatcgtggacggcgga
aacatcttccacatatggctcggggaggcccggcccgatccgcgtgggctcatggatatg
gccatgaacctctgccggaacacgcagatcgggtacttcgcattcacccgggatctcacc
gtgccgctccggcagttccgtgagttccggccggaaaagagggcggaaggatcgtggatg
ccaccggcagatgtgccggcaaaggcataa
DBGET
integrated database retrieval system