Methanoregula boonei: Mboo_1894 Help Entry Mboo_1894         CDS       T00578                                  Name (GenBank) Exonuclease VII, small subunit   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism mbn  Methanoregula boonei Pathway mbn03430   Mismatch repair Brite KEGG Orthology (KO) [BR:mbn00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     Mboo_1894  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:mbn03400]     Mboo_1894 Enzymes [BR:mbn01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      Mboo_1894 DNA repair and recombination proteins [BR:mbn03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      Mboo_1894 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S KxDL Nsp1_C COG3_N DASH_Duo1 FH2 Motif Other DBs NCBI-ProteinID:  ABS56409 UniProt:  A7I9J8 LinkDB All DBs Position 1959524..1959718 Genome browser AA seq 64 aa AA seqDB search MWTMTGTYEEKIEELRQIIAKIEDGTTSLDESMKLYEQGAALVKQCETLLADAEEKITTL ARGA NT seq 195 nt NT seq  +upstreamnt  +downstreamnt gtgtggaccatgacgggaacctatgaggaaaagatcgaagaactgcggcagatcatcgca aagatcgaggacggcacgacgagccttgacgagagcatgaagctctacgaacaaggggcg gcacttgtgaagcagtgcgagacgcttcttgctgatgcagaagagaagatcacgacgctg gcccggggcgcgtaa

DBGET integrated database retrieval system