KEGG   Methanoregula boonei: Mboo_1956
Entry
Mboo_1956         CDS       T00578                                 
Name
(GenBank) histone acetyltransferase, ELP3 family
  KO
K07739  elongator complex protein 3 (tRNA carboxymethyluridine synthase) [EC:2.3.1.311]
Organism
mbn  Methanoregula boonei
Brite
KEGG Orthology (KO) [BR:mbn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mbn03016]
    Mboo_1956
Enzymes [BR:mbn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.311  tRNA carboxymethyluridine synthase
     Mboo_1956
Transfer RNA biogenesis [BR:mbn03016]
 Eukaryotic type
  tRNA modification factors
   Elongator complex
    Mboo_1956
SSDB
Motif
Pfam: Radical_SAM_C ELP3_N Radical_SAM Acetyltransf_1 Acetyltransf_7 Acetyltransf_10
Other DBs
NCBI-ProteinID: ABS56471
UniProt: A7I9R0
LinkDB
Position
complement(2020334..2021914)
AA seq 526 aa
MDEALAIREIISLILSHPQGENGIVAAKIETCRKYRLNAVPKNSAILAAATPDERETLRR
ILLVKPTRTLSGVAPVAVMTSPYPCPHGRCLPCPGGPSHPFSSPQSYTGEEPAAKRAREN
GYDPFAQVHARLSQFETLGHRVEKVELIVMGGTMTARPIEYQHEFVARCIEAMNLYPENT
PAASPPAVEGVQSANEISDVRCVAITFETRPDWCRKEHINRMLDLGVTKVELGVQHLDDE
ILAFNRRGCTVADTAEANRLLRDAGIKVGFHMMPNLPHSTIAADKAMFETLFSDPRFKPD
FLKIYPTLVTPGSEIEELWELKRYAPYDEETLIDLIAYAKMLIPEYTRLSRVQRDIPAKL
IVAGSRHSNFRQLAQNRLAAQGRRCRCIRCREIGRLPSADEAEIRVIRYECCGGMEHFIS
AVAGDSLIGFARLRFPSAEFRPEIAGAALLRELHVYGSLVPVGIDAAEQEEYQHRNFGKI
LLSRAEEIAQAAGFGSMAIMSGIGVRPYYRRQGYERNGPYMVKEMP
NT seq 1581 nt   +upstreamnt  +downstreamnt
atggatgaggcgctggcgattcgggagatcatctccctcatcctctcccatcctcaaggt
gagaacgggatcgttgccgcaaagatcgagacctgccggaagtaccggctgaatgcggtt
cccaagaattcggcgatacttgccgcagccactcctgatgagcgggagactttgcggcgt
atcctgctggtcaagcccaccaggacgctctcgggagttgcgccggttgcggtcatgacc
tctccgtatccatgcccgcacgggcggtgccttccctgcccgggcggtccttcccatcct
ttcagctcgccccagagttacaccggggaagaacccgcagcaaagcgggcccgggagaat
ggctacgatccatttgcccaggtccatgcgcggctcagccagttcgagacgctggggcac
cgggtggaaaaggtggaattgattgtgatgggcgggaccatgaccgcccgcccgattgag
taccagcatgaatttgttgcccggtgcatcgaagcaatgaatctctatcctgaaaacacg
cccgcagcctcccctccggcagttgaaggagtccagtcagcaaatgagatatcagatgtc
cggtgcgtggcgatcacgttcgaaacacgccccgactggtgcaggaaagaacatatcaac
cggatgctcgatcttggcgttaccaaagtggagctgggcgtccagcatctggatgacgag
atacttgccttcaaccgtcggggatgtacggttgcagacaccgcggaagcaaaccggctc
ctgcgggacgcagggatcaaggtcggattccacatgatgccaaatctgccgcattcgacc
atcgcggcagataaggcaatgttcgagactctcttctccgatccccggtttaagccggat
ttcctgaagatctacccgaccctggtcacccccggctcagagatcgaggagctctgggaa
ctcaagcggtatgccccgtacgatgaggagacgcttatcgatcttattgcatatgcaaaa
atgctcatcccggagtacacacgcctatcgagggtgcagcgcgatatcccggccaagctg
atcgtggccggatcccggcattccaatttccggcagctggcccagaaccggcttgccgca
cagggccggcgctgccgctgcatccggtgccgggagatcggccgtctcccctcagcagat
gaggcggagatccgggtgatccggtacgagtgctgcgggggcatggaacatttcatatcg
gctgtagctggtgattctctgattgggtttgcccgtctccggtttccctcggccgagttc
cgtcctgagattgccggtgccgcgctcctccgcgagctccacgtatacgggagccttgtc
ccggtggggatcgatgcggcagaacaggaggagtatcagcaccggaattttgggaagatt
ctgctctcccgggctgaggagattgcacaggccgcaggcttcgggagtatggctattatg
agcggcatcggagtccggccctattaccggcggcagggatatgagcgcaacgggccctat
atggtaaaggagatgccatga

DBGET integrated database retrieval system