Macrococcoides bohemicum: HT586_05670 Help Entry HT586_05670       CDS       T07164                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mboe  Macrococcoides bohemicum Pathway mboe00998   Biosynthesis of various antibiotics mboe01100   Metabolic pathways mboe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mboe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HT586_05670    00074 Mycolic acid biosynthesis     HT586_05670   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HT586_05670 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 DUF7080 Motif Other DBs NCBI-ProteinID:  QRN49681 LinkDB All DBs Position 1094548..1094781 Genome browser AA seq 77 aa AA seqDB search MENFDKVKEIIVDRLGVDADKVTENASFKDDLGADSLDIAELVMELEDQFGMEIPDEEAE KINTVGDAVKYIESLEA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggaaaacttcgacaaagtaaaagaaatcatcgttgatcgcttaggcgttgatgcagat aaagttactgaaaatgcttcatttaaagatgatttaggtgctgattctttagatatcgct gaattagtaatggaattagaagatcaatttggaatggaaattccggatgaagaagctgaa aaaatcaacacagttggtgatgcagtcaaatacatcgaatctttagaagcttaa

DBGET integrated database retrieval system