Moraxella bovis: DQF64_08045 Help Entry DQF64_08045       CDS       T05535                                  Name (GenBank) exodeoxyribonuclease VII   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism mboi  Moraxella bovis Pathway mboi03430   Mismatch repair Brite KEGG Orthology (KO) [BR:mboi00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     DQF64_08045  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:mboi03400]     DQF64_08045 Enzymes [BR:mboi01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      DQF64_08045 DNA repair and recombination proteins [BR:mboi03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      DQF64_08045 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S Motif Other DBs NCBI-ProteinID:  AWY20447 UniProt:  A0AAQ2PZJ1 LinkDB All DBs Position complement(1536265..1536492) Genome browser AA seq 75 aa AA seqDB search MSQKSSDTASLTTFKEAYEILKHNADSLEQSQVLDIDNLVSVVEQSIDAYKVCQERINAV ELALKHAFDETALKN NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgtcccagaagagcagtgataccgcatctttgacaacttttaaagaagcctacgaaatt ttaaagcataatgctgactcattagaacaaagtcaggtgttagacattgacaacctagtg agcgtggtagagcaatccattgatgcttataaagtctgtcaagaacgcattaatgctgta gaactggcattaaaacatgcctttgatgagactgccttaaaaaactaa

DBGET integrated database retrieval system