KEGG   Mycolicibacterium boenickei: MBOE_12640
Entry
MBOE_12640        CDS       T07414                                 
Name
(GenBank) hypothetical protein
  KO
K27098  ESX secretion-associated protein EspA/E
Organism
mbok  Mycolicibacterium boenickei
Brite
KEGG Orthology (KO) [BR:mbok00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mbok02044]
    MBOE_12640
Secretion system [BR:mbok02044]
 Type VII secretion system
  ESX secretion system protein
   MBOE_12640
SSDB
Motif
Pfam: EspA_EspE YidB
Other DBs
NCBI-ProteinID: BBX89615
UniProt: A0ABM7IS44
LinkDB
Position
1346860..1348656
AA seq 598 aa
MTVQQICAANPGAHRNPGAKWRARDGAGHRRRHIARRVRSPCVAIWAPPGKRSLNCNKRW
SESLPGPSIKPGRSAEIGALTGPDALVISVPAKGIRGMGLLGDIAAFGKGVIENNLKLAE
RAANFFASQIGPRLIRAARSPIMVAGQQTIESMKRSTGVGDPESGQRFGDGAEQMGAVGQ
VLASAFPDDSWNSGGASAYAGRNTEQVGRVQTMLGLDNMVAGVLSAEAGQIAAARDSLDG
HSDWLGAMSLLTTSAGIIPGFGTAAQMSAEVAMVAKAISDSSGDLKTLHGHIDQNAAVLR
TAAAQYATLAGAAAPNGAEFAPPAGEDPDAAPAPADPEADVPGGSPSSADAPSGGGASGG
GAPSGGGGGGAPTSAPTSASAPSMPSTVPASATPPNSAAASEAAGALGGILGSLVSPLGG
ILGGVLQAAGQAATQAAQAGTQAAQLGSQAAGQVGGAGTDAAQLDKVSDSADADGRADGD
RDDRDKDDQDDDKAGRDEADEKDDKDGEGREDEPDEGRAGGPPAADSAGEPADPPDAGGD
DEAAKTLPPDLEAVAAGRGVAGPAPVHVGADFEQGQLHMAAAATLDRGVPGSAAVIDR
NT seq 1797 nt   +upstreamnt  +downstreamnt
atgacggtgcagcaaatttgcgcggcaaaccccggcgcacaccggaacccgggtgcaaag
tggcgagccagggacggcgcgggacaccggcggcgccacattgcgcgccgcgtacggagc
ccgtgcgtcgcgatttgggcaccgcccggaaaacgctctctcaactgcaataaacggtgg
tcggagtcccttccgggaccgtccatcaagccgggtcggagtgccgaaattggtgcgctg
accgggcctgatgcgctggtaatctctgttccggcgaaggggatacggggtatggggctg
ctgggtgatattgccgctttcggcaaaggcgtgatcgagaacaatctgaagttggccgag
cgcgccgccaacttcttcgcatcccagatcggcccgcgtctgatcagggcggcccggtcg
cccatcatggtcgccggtcagcagaccatcgagtcgatgaagcgcagcaccggagtcggg
gatccggagagcgggcagcgcttcggtgacggggcagagcagatgggcgcggtcgggcag
gtgctcgcgtcggccttccccgacgacagctggaacagcggcggggccagcgcctacgcc
ggccgcaacaccgagcaggtcggccgcgttcagaccatgctcgggctggacaacatggtg
gccggggtgttgtcagccgaggccggccagatcgcggctgcccgcgacagcctcgatggg
cattccgactggctgggcgcgatgagcctgctcaccacgagtgcgggcatcatcccgggt
ttcggaacggcggcccagatgtcggccgaggtcgcgatggtcgccaaggccatcagcgat
tcgagcggcgacctgaaaaccttgcatgggcacatcgatcagaacgcggccgtgttgcgt
accgcggcagcgcaatacgcgacgctggccggcgctgccgcccccaacggcgcggagttc
gccccgccggccggggaggacccggacgcggcgcccgcaccggcagaccccgaggcagac
gtgccgggcggctccccgagcagcgccgacgccccctccggtggcggcgcgtccggcgga
ggtgcaccgtccggcggtggcggaggtggcgcacccacgagtgcgccgacttccgcatcg
gcgccctcgatgccgtcgaccgtgccggcatccgcgacccctccgaactcagccgccgcc
tccgaagctgccggcgcgctcggcgggattctcgggtcgttggtgagcccgctcggcggg
attctcggcggcgtattgcaggccgccgggcaggcggccacccaggcggcacaggctggg
acccaggcggcgcagctgggcagtcaggccgccgggcaggtgggcggcgccggtaccgac
gcggcccagctcgacaaggtgtccgacagcgccgatgccgacggccgcgccgacggagac
cgggacgaccgcgacaaggacgatcaggacgacgacaaggccggccgcgacgaggcggac
gaaaaggacgacaaggacggcgaaggccgagaggacgagcctgacgagggtcgggcgggc
ggcccgcccgcagcggattccgccggtgaaccggctgatccgcccgacgccggaggggac
gacgaggccgccaagacactgccgcctgacctggaggccgtggccgccggccgcggcgtc
gcgggcccggctccggtgcatgtcggggcggatttcgagcagggccagctgcacatggca
gcggcggctacattagatcgcggtgtacccggatctgcggccgtgatcgacaggtaa

DBGET integrated database retrieval system