KEGG   Monosiga brevicollis: MONBRDRAFT_21358
Entry
MONBRDRAFT_21358  CDS       T01042                                 
Name
(RefSeq) hypothetical protein
  KO
K14455  aspartate aminotransferase, mitochondrial [EC:2.6.1.1]
Organism
mbr  Monosiga brevicollis
Pathway
mbr00220  Arginine biosynthesis
mbr00250  Alanine, aspartate and glutamate metabolism
mbr00270  Cysteine and methionine metabolism
mbr00330  Arginine and proline metabolism
mbr00350  Tyrosine metabolism
mbr00360  Phenylalanine metabolism
mbr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mbr00710  Carbon fixation by Calvin cycle
mbr01100  Metabolic pathways
mbr01110  Biosynthesis of secondary metabolites
mbr01200  Carbon metabolism
mbr01210  2-Oxocarboxylic acid metabolism
mbr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbr00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation by Calvin cycle
    MONBRDRAFT_21358
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MONBRDRAFT_21358
   00270 Cysteine and methionine metabolism
    MONBRDRAFT_21358
   00220 Arginine biosynthesis
    MONBRDRAFT_21358
   00330 Arginine and proline metabolism
    MONBRDRAFT_21358
   00350 Tyrosine metabolism
    MONBRDRAFT_21358
   00360 Phenylalanine metabolism
    MONBRDRAFT_21358
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MONBRDRAFT_21358
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mbr01007]
    MONBRDRAFT_21358
Enzymes [BR:mbr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     MONBRDRAFT_21358
Amino acid related enzymes [BR:mbr01007]
 Aminotransferase (transaminase)
  Class I
   MONBRDRAFT_21358
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-GeneID: 5889765
NCBI-ProteinID: XP_001744723
JGI: 21358
UniProt: A9UVY5
LinkDB
AA seq 399 aa
MAASSSVWADVPMGPPDAILGITEAFKKDTSSVKANLGVGAYRTDEGKPFVLSCVRKAEE
RILQENLNKEYAAITGVDEFRGLAARLAYGPNSPALQDKRVATAQALSGTGALRVAGHLM
PTIWMPTPTWGNHLPIFRDAGLEIGQFRYYDKSTCGLDFDGLIDDLKTKPQEGEFVLLHA
CAHNPTGVDPTPDQWKEIASVMKSRNLRVLFDMAYQGFASGNSDQDAWALRHFVSEGFQP
IVTQSFSKNMGLYGERVGLLSVVTGSPEEAAAVESQIKIIIRPMYSNPPVHGARIAAYVL
KDEQLYNEWLSEVKNMADRINTMRQELVRLLTEYGSTLNWNHITNQIGMFCYTGLTPEQV
DRMRDEFHVYMTKDGRISVAGVSSNNVEHIARAIHEVTK
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggccgcgtcctcctcggtctgggcggacgtccccatgggcccacccgatgccattctg
ggcatcaccgaggcctttaagaaggacaccagtagcgtcaaggccaacctcggcgtcggt
gcctatcgcacagatgagggcaagccgtttgtcctttcctgcgtccgcaaggcggaagaa
cgcatccttcaagaaaacttgaacaaggaatatgctgccattacaggcgtggatgagttt
cgcggcctcgccgcccgcctagcctacggcccaaactcccccgcactgcaggacaagcga
gtggcaacggcacaagcgttgagcggcacgggcgcgctccgcgttgctggacatctcatg
ccaaccatttggatgccgacccccacctggggtaaccacctccccatcttccgggatgcc
ggtctcgagattggccagttccgctactatgacaagagcacgtgtggccttgattttgac
ggcttgattgacgacttgaagaccaagccccaagaaggcgagtttgttcttctccatgcc
tgtgcccacaacccgacgggcgtggatcccaccccagatcaatggaaggagattgccagt
gtcatgaagagtcgcaacctgcgcgtcctttttgacatggcctaccagggttttgccagc
ggcaacagcgatcaggatgcgtgggcacttcgccattttgtctccgagggattccagccg
atcgtgacccagtcgttttccaagaacatgggcctttacggcgagcgtgtgggtctgttg
tccgtggtgaccggctccccagaagaagccgccgccgttgagtcgcagattaagatcatt
atccgtcccatgtactcaaacccgcccgttcatggtgcgcgcatcgccgcctacgttctc
aaggatgagcagttgtacaacgagtggttgtcagaggttaagaacatggctgatcgcatc
aataccatgcgccaggagctggtgcgccttctgaccgagtatggctcgactctcaactgg
aaccacatcaccaatcagattggcatgttctgctacacgggtcttacgcccgagcaggtg
gaccgtatgcgcgatgaatttcacgtgtacatgaccaaggacggccgcatctctgttgcc
ggtgtctcctccaacaacgttgagcacattgcccgcgccattcatgaggtgaccaagtaa

DBGET integrated database retrieval system