Monosiga brevicollis: MONBRDRAFT_24957 Help Entry MONBRDRAFT_24957  CDS       T01042                                  Name (RefSeq) hypothetical protein   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism mbr  Monosiga brevicollis Pathway mbr03020   RNA polymerase mbr03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:mbr00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     MONBRDRAFT_24957   09124 Replication and repair    03420 Nucleotide excision repair     MONBRDRAFT_24957  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:mbr03021]     MONBRDRAFT_24957    03400 DNA repair and recombination proteins [BR:mbr03400]     MONBRDRAFT_24957 Transcription machinery [BR:mbr03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      MONBRDRAFT_24957   RNA polymerase III system    RNA polymerase III      MONBRDRAFT_24957   RNA polymerase I system    RNA polymerase I      MONBRDRAFT_24957 DNA repair and recombination proteins [BR:mbr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       MONBRDRAFT_24957 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Zn_ribbon_RPAB4 Zn_ribbon_3 CoiA_N zf-LITAF-like Motif Other DBs NCBI-GeneID:  5890696 NCBI-ProteinID:  XP_001745404 JGI:  24957 UniProt:  A9UY90 LinkDB All DBs AA seq 101 aa AA seqDB search MDARGATTGTGATPIVPRDKSQMVYVCGECRNPNQIKAGGDINCRNCGHRILYKLRTERG RSFAGFGFVCVWCFSAYLLSCCNLLTFHVPLIAPDPSSHPL NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggatgctcgtggcgcaacgactggcacaggggccacccccatcgtgccccgggacaag tcgcaaatggtttacgtctgtggtgaatgccgcaatcccaaccagatcaaggccggaggt gatatcaactgccgcaactgcggtcaccgcatcctctacaagcttcgcaccgagcgcggt cggtcatttgctggttttgggtttgtgtgtgtgtggtgtttttccgcgtatcttttgagt tgttgcaacctgctcaccttccacgtacctctgatcgcaccggacccatctagccatcca ctttga

DBGET integrated database retrieval system