Monosiga brevicollis: MONBRDRAFT_32960 Help Entry MONBRDRAFT_32960  CDS       T01042                                  Name (RefSeq) hypothetical protein   KO K03008   DNA-directed RNA polymerase II subunit RPB11 Organism mbr  Monosiga brevicollis Pathway mbr03020   RNA polymerase mbr03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:mbr00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     MONBRDRAFT_32960   09124 Replication and repair    03420 Nucleotide excision repair     MONBRDRAFT_32960  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:mbr03021]     MONBRDRAFT_32960    03400 DNA repair and recombination proteins [BR:mbr03400]     MONBRDRAFT_32960 Transcription machinery [BR:mbr03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Core subunits      MONBRDRAFT_32960 DNA repair and recombination proteins [BR:mbr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       MONBRDRAFT_32960 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_L_2 RNA_pol_L Motif Other DBs NCBI-GeneID:  5892448 NCBI-ProteinID:  XP_001747136 JGI:  32960 UniProt:  A9V2R7 LinkDB All DBs AA seq 119 aa AA seqDB search MNAPDPFESFRLEDGEAKITYEPDSKVPNAGTFRMNREDHTVGNLLASQLAKDPRVLFAG YKVPHPLEHYILLRVHTTAQYSPKEALKQALHDVIYDVAHLQSSLREQLPSEEFDNRMG NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgaacgcacccgatccctttgagagctttcgcttggaggatggcgaagccaaaattaca tacgagcccgattcaaaggtgcccaacgcgggcactttccgcatgaaccgcgaggatcac accgtcggcaaccttttggccagtcaattggccaaggatccccgcgttctttttgcaggc tacaaggtgccccatcctttggagcactacattttgctgcgagtgcataccacggcacag tacagccccaaggaggctctgaagcaggccttgcacgatgtcatctacgatgtggcccac ttgcaaagctcacttcgggagcaattgccttcagaagagtttgacaaccgcatgggataa

DBGET integrated database retrieval system