Microbulbifer bruguierae: PVT68_06515 Help Entry PVT68_06515       CDS       T09733                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism mbrg  Microbulbifer bruguierae Brite KEGG Orthology (KO) [BR:mbrg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mbrg03036]     PVT68_06515 (ftsL) Chromosome and associated proteins [BR:mbrg03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     PVT68_06515 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC DUF6468 Motif Other DBs NCBI-ProteinID:  WGL17946 UniProt:  A0ABY8NG89 LinkDB All DBs Position complement(1528977..1529249) Genome browser AA seq 90 aa AA seqDB search MSGNKGLLLVVWSLLMVSALGVVHTTQQSRELTAQLEQAQRHRDELRYEQERLLLERGAW SAYSRIEQVAKDKLKMRAPTPAERVLVPGR NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgagcggaaataaaggattgttgctcgttgtctggtcgctgttgatggtgtcggcattg ggtgttgtgcataccacccagcagagccgcgaactcaccgcccagctcgagcaggctcag cgacaccgagatgagttgcgctatgagcaggagcggttattgctggagcgcggcgcctgg tctgcctatagccgtatcgagcaggtggcaaaagataaattgaagatgcgggcgccgaca ccggcagagcgcgtactggtgccgggccgctag

DBGET integrated database retrieval system