Methanococcoides burtonii: Mbur_1653 Help Entry Mbur_1653         CDS       T00341                                  Symbol rpl40e Name (GenBank) LSU ribosomal protein L40E   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism mbu  Methanococcoides burtonii Pathway mbu03010   Ribosome Brite KEGG Orthology (KO) [BR:mbu00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Mbur_1653 (rpl40e)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Mbur_1653 (rpl40e)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mbu03011]     Mbur_1653 (rpl40e)    04121 Ubiquitin system [BR:mbu04121]     Mbur_1653 (rpl40e) Ribosome [BR:mbu03011]  Ribosomal proteins   Eukaryotes    Large subunit     Mbur_1653 (rpl40e)   Archaea     Mbur_1653 (rpl40e) Ubiquitin system [BR:mbu04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Mbur_1653 (rpl40e) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e zf-AtTam37 DZR Zn_Ribbon_1 DZR_2 Zn_ribbon_ZPR1 DUF7577 Cas12f1-like_TNB zf-ChsH2 Zn_ribbon_3 Zn_ribbon_13 Zn_ribbon_RPAB4 Zn_ribbon_RanBP Motif Other DBs NCBI-ProteinID:  ABE52553 UniProt:  Q12VH3 LinkDB All DBs Position complement(1733503..1733652) Genome browser AA seq 49 aa AA seqDB search MARFPEAEERILNKKICMKCSARNAVRATRCRKCGYTNLRVKNKDVRRG NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggcaagattcccagaagcagaagaaaggatccttaataagaagatctgtatgaagtgc agtgcccgcaatgctgttagggcaacaagatgtagaaagtgcggttacacaaatctacgt gtgaaaaacaaggacgtcagaagaggctga

DBGET integrated database retrieval system